KEGG   Neorickettsia sennetsu: NSE_0254Help
Entry
NSE_0254          CDS       T00329                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nse  Neorickettsia sennetsu
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSE_0254 (tpiA)
   01230 Biosynthesis of amino acids
    NSE_0254 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSE_0254 (tpiA)
   00051 Fructose and mannose metabolism
    NSE_0254 (tpiA)
   00562 Inositol phosphate metabolism
    NSE_0254 (tpiA)
Enzymes [BR:nse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NSE_0254 (tpiA)
Exosome [BR:nse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NSE_0254 (tpiA)
  Exosomal proteins of bladder cancer cells
   NSE_0254 (tpiA)
  Exosomal proteins of melanoma cells
   NSE_0254 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215641..216366
Genome map
AA seq 241 aa AA seqDB search
METCVQRFVVANWKMNGSQQLCDVFVNRFSAFAFNPEVEIVIAPPAVYLGQMRAAVMSSD
LPLALGAQDCASGDNTPSTGDISSRMFKEVGARYVLVGHSERRTLHCESSKVVGMKANAG
LRSRLIPIICVGQNNRPINRESLTKQCRDSIPMNSHDFIVAYEPVYAIGTGIVPSNEEIE
EAVCLIKDAVGDAVPVLYGGSVSPVNCSEIFAVKNLGGVLVGGASLDPDSFIKICEVANR
F
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttgtgtgcagcgcttcgtggttgcaaattggaagatgaatggcagtcagcaa
ttgtgtgatgtttttgtgaatcgcttttctgcttttgctttcaaccctgaggtcgagatt
gtaatagcacctccggctgtctacttaggacagatgagagctgctgtaatgtcttctgat
ttgcccttagctctgggagcacaggattgcgcttcaggtgataatactcctagcactggt
gacataagttctaggatgtttaaagaggttggtgcgaggtatgttcttgtaggacattcc
gagaggaggactttgcactgtgaatcgagtaaagtggtgggtatgaaggccaatgctgga
ttacgcagtcgccttataccgatcatttgtgtcggacagaataacagacctataaataga
gagagtctgactaagcaatgtagggattcaattccaatgaatagccacgacttcatagtg
gcctacgagccggtctatgccataggaacaggtatcgtgccttcgaacgaggagattgag
gaggcagtctgtttaatcaaggatgctgttggagatgcagtaccagtgctttatggtggt
tctgtttctccagttaattgctcagagatttttgctgtgaagaaccttggtggagtgctt
gtaggtggtgcgagcttagatccggatagcttcatcaagatctgtgaggttgcaaatcgg
ttttga

DBGET integrated database retrieval system