KEGG   Neorickettsia sennetsu: NSE_0441Help
Entry
NSE_0441          CDS       T00329                                 

Definition
(GenBank) hypothetical protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nse  Neorickettsia sennetsu
Pathway
nse00860  Porphyrin and chlorophyll metabolism
nse01100  Metabolic pathways
nse01110  Biosynthesis of secondary metabolites
nse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NSE_0441
Enzymes [BR:nse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NSE_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PTPA
Motif
Other DBs
NCBI-ProteinID: ABD45702
UniProt: Q2GDX0
Position
358184..358894
Genome map
AA seq 236 aa AA seqDB search
MILITRPVEDAVYLQRRLQSLKIESLVEALFVVQPLWFDVATLVAAKVVVSSKNAIRALT
WSNASNDLQLYTMSDNIARFAVSSGFSNVFSCSCHTAEELEAYVLSYFGKDERIIYLSGA
EITRDIVSTCLEKGFRWVERRICYMMCPLKEFSGNVCVALRRKRITCVTLFSVQAAVLCK
SLFLKHGISPDFFSYFVMSSRIASILDCDTVYVSSVPTLDALVDVIERHYYVEQRG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgataacaaggccagttgaggatgctgtatacttgcagcgacggctacaaagt
ttaaaaatagaaagtcttgtggaagcgctctttgtagtgcaaccgctttggtttgatgtt
gcaacgctcgttgctgcaaaggttgttgttagcagtaaaaatgccattagagccttaact
tggtccaatgccagtaatgatttgcaattgtacacaatgagtgacaatattgctaggttt
gcagtttctagtggattttctaatgttttttcgtgcagttgtcataccgctgaggaatta
gaagcttatgtgctttcttactttggcaaagacgagaggattatttatctttctggagcg
gaaataactagagatattgtttccacatgtttagaaaagggttttagatgggtagagcgc
cgaatctgctatatgatgtgcccattgaaagagttttccggtaatgtatgtgttgcgtta
aggagaaagagaattacttgtgtaactttgttttcagtgcaggcagcggttttgtgcaaa
tctctgttccttaagcatggcataagtccggattttttctcttatttcgttatgagcagt
agaatagcatcgattttggattgtgatacagtttatgtgtctagtgttcctactttagat
gcccttgttgatgtaatagaaaggcattactatgttgagcagagaggttaa

DBGET integrated database retrieval system