KEGG   Neorickettsia sennetsu: NSE_0473Help
Entry
NSE_0473          CDS       T00329                                 

Gene name
cycM
Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
nse  Neorickettsia sennetsu
Pathway
nse01100  Metabolic pathways
nse01120  Microbial metabolism in diverse environments
nse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nse00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NSE_0473 (cycM)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NSE_0473 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABD46198
UniProt: Q2GDT8
Position
complement(390975..391514)
Genome map
AA seq 179 aa AA seqDB search
MKDLEFNKLFASVLLFGITVLSVSNVVDALYHPREVTHYQYAVTSAETIESQTNKFDPAA
VDMTTFFKDANIEEGKKLAKKCVACHTFEKGGHNKVGPNLWDILGKNKAHLGDAFKYSKA
LLEKGGTWDYNSMIHLLYKPAQYIKGTKMSFAGLSNPQDIANLIAYLRSLSDSPVPLPE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctggaatttaataagctttttgcatctgtgcttctctttggaataacggtt
ctgtcggtaagcaacgtagtggatgccctctaccatcccagagaggttacacattaccaa
tatgcagttacgagtgctgagactatagagtcacaaacaaacaaatttgatccggcagcc
gttgatatgactaccttcttcaaagatgcaaacatagaagagggtaaaaaattagctaaa
aagtgcgttgcctgtcacacctttgagaagggtggacataacaaagttggtcctaatctt
tgggatattttgggaaaaaataaagcccacttgggggatgcatttaaatattccaaagct
ttactggaaaaaggtggtacctgggattataactcaatgatacatctactatacaaacca
gcccagtacatcaagggaactaagatgtcatttgcgggactttccaatcctcaggatata
gcaaatctaatcgcatacctacgtagtctctctgattcacctgttccgctgccagaataa

DBGET integrated database retrieval system