KEGG   Neorickettsia sennetsu: NSE_0587Help
Entry
NSE_0587          CDS       T00329                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nse  Neorickettsia sennetsu
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nse00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(509055..509597)
Genome map
AA seq 180 aa AA seqDB search
MQKLSEGDIQDFFGVGVGETDRLGARGASHSFLKMFANYFSGYACSDFSSLVAKMENPDG
GESLLVLKRTPFLSFCEHHVLPISGYISIGYIPDKSITSLGSLGRLVSACTKRLQLQERI
CAQIALAIEESLSPKGVIVYASAKHACVAHNTSVFESVAKRGAFAANTKGEVQEFFSILK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagttatctgagggcgatattcaggattttttcggtgtcggggtaggtgagact
gatcgcctaggggcacgtggtgcgtcacactcatttctcaagatgtttgcaaactatttt
tcgggttatgcatgcagcgacttctcttctcttgtggcaaaaatggaaaatcccgatgga
ggtgagtctttgctcgtgctaaaaaggactccatttttgtctttttgcgaacaccatgtt
ttacccatttcagggtatatttctatcggatacattccggataagagtatcacaagtctt
gggagtctaggaagattggtaagtgcttgtactaaaagactgcagttacaagagaggatt
tgtgctcagattgcacttgcaattgaggaatctctgtctccaaaaggagtaatagtgtat
gcttcagccaagcatgcttgcgtggcgcataatacctcggtctttgagtctgtagcaaaa
agaggggctttcgctgctaacaccaaaggagaagttcaagaatttttttctatcttaaaa
taa

DBGET integrated database retrieval system