KEGG   Neorickettsia sennetsu: NSE_0671Help
Entry
NSE_0671          CDS       T00329                                 

Gene name
lpdA-2
Definition
dihydrolipoamide dehydrogenase (EC:1.8.1.4)
Orthology
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
nse  Neorickettsia sennetsu
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NSE_0671 (lpdA-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NSE_0671 (lpdA-2)
   00020 Citrate cycle (TCA cycle)
    NSE_0671 (lpdA-2)
   00620 Pyruvate metabolism
    NSE_0671 (lpdA-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NSE_0671 (lpdA-2)
   00280 Valine, leucine and isoleucine degradation
    NSE_0671 (lpdA-2)
Enzymes [BR:nse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     NSE_0671 (lpdA-2)
Exosome [BR:nse04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NSE_0671 (lpdA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
586511..587917
Genome map
AA seq 468 aa AA seqDB search
MCHFFVRMSEKEFDVVVIGGGPAGYVCSIKAAQLGMKVACVEKRPSLGGTCLNEGCIPSK
ALLHSSYAYYSAKKCFDVLGVECSDVKLNLTKMMGNKSRIVMELSQGIEFLFKKNKVTRF
TGTGSILANGDTKKKSVIIDKTETIHTKYVVLATGSEAAELPFAKCDEKSILSSRGALEL
DAVPKSMIIIGGGAIGLEMASIWSRLGTEVTLMEYADRIAAASDGEVSDYLLKSLTKQGI
KFHLSSRITEIKKGKLLSATFEKDEKIGSISAEKILVAVGRRPYSANIGVELERNPSGFI
KVDKNFQTSVPGVYAIGDTIPGVMLAHKAEEEGVAVAEILAGRTGHIGWIPSVIYTHPEV
ASVGKTEEELKVIGIKYKASKFPFAANSRAKTTNDTGGFVKMLVDEHDTVLGVHIVGPSA
SSLIAEAVLAMEYGASAEDIARTCHSHPDLNEAMKEAALGAFFKPIHF
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtcacttttttgtgagaatgtccgagaaagagtttgatgtagttgtcataggcggc
ggccccgctggatacgtgtgtagtataaaagcggcacaactcggtatgaaggttgcatgt
gtagaaaaacgcccttctctcggtgggacatgtctgaacgaaggatgtatcccttccaag
gcgttactccactcatcctacgcttactattctgctaaaaagtgctttgatgttctcgga
gtagaatgctctgatgtaaagttgaacctaacaaaaatgatgggaaataaatccagaata
gtgatggaattatcccaaggcatcgagtttttattcaagaaaaataaggttactcggttt
actggaacgggcagcatactagccaatggtgatacaaaaaaaaaatccgtcattattgac
aaaactgagaccatacacacaaagtatgttgttcttgcaactggttccgaggcagctgag
cttccgttcgcgaagtgtgatgagaaaagcatcttatcatcacgtggcgcattagagctg
gacgctgtccctaaaagcatgattatcattggagggggagcaataggactggaaatggct
tccatttggtcaagacttggcactgaggtcacccttatggaatacgcggacagaatcgca
gcagcctcagatggtgaagtcagcgactatcttctgaaatcactaacaaaacaaggtata
aagttccatctctccagtaggattacagagataaaaaaaggaaagcttctttctgcaacc
tttgagaaagatgaaaaaataggaagtatatcagcagaaaaaattctagtcgccgttggc
aggcgtccatactcagccaatattggtgttgagctggagaggaacccgtctggtttcata
aaggtagataaaaatttccaaaccagcgttcctggagtatatgccataggggacacaatt
ccgggggtaatgctagctcacaaagccgaggaagaaggggtagctgtagcagaaatccta
gcaggtaggacaggccacattggatggattccatctgtaatatatactcacccagaagtt
gcaagtgtaggaaaaaccgaggaagaattgaaagtcataggtataaaatacaaagcctcc
aaatttccgtttgcagctaatagtcgggctaaaacgactaacgacacaggaggttttgta
aagatgttagttgatgagcacgacaccgtactcggtgtgcacatagtcggaccatctgct
tcttcacttatagccgaagccgtcctggcaatggaatatggtgcttcagcggaggatatc
gcgagaacctgccactctcacccagacctaaacgaagcaatgaaagaagccgctctagga
gcatttttcaagccaatacatttctaa

DBGET integrated database retrieval system