KEGG   Nicotiana sylvestris: 104240874Help
Entry
104240874         CDS       T05026                                 

Definition
(RefSeq) acid beta-fructofuranosidase AIV-18
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
nsy  Nicotiana sylvestris
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104240874
   00500 Starch and sucrose metabolism
    104240874
Enzymes [BR:nsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104240874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 643 aa AA seqDB search
MATHHSHYDPENSTTHYTVLPDQPESAGAGRRKSLKVVSGILLSSFFLLSLVFVILNQSS
DLSQENSRSSETLTPALSRGVSQGVSEKTFKDVSGRSLSYYPWTNAMLTWQRTAYHFQPQ
KNWMNDPNGPLYHKGWYHLFYQYNPDSAIWGNITWGHAISTDLIHWLYLPFAMVPDQWYD
INGVWTGSATILPDGQIMMLYTGDTNDYVQVQNLAYPANLSDPLLIDWVKYQDNPVMVPP
PGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGIALVYDTSNFTNFKLLDGVLHAVPG
TGMWECVDFYPVSTVEANGLDTSYNGPGIKHVLKASLDDDKHDYYAIGTYDPVKNKWTPD
NPELDVGIGLRLDYGKYYASKTFYDPKEQRRILWGWIGETDSEAADLLKGWASVQSIPRT
VLYDKETRTHVLQWPVKEIESLRIGDPLVKQVNLQPGSIELVHVDSAAQLDVEASFEVDK
AALAGTIEADVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGTGGRAET
YFCADETRSSEAPGVAKQVYGSSVPVLDGEQHSMRLLVDHSIVESFAQGGRTVITSRIYP
TKAINGAARLFVFNNATGASVTASLKIWSLKSADIRSFPLDQL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccattcccattatgacccggaaaactccacgacccattacactgtccta
ccggatcaacccgaatccgccggcgccgggcgccggaagtctcttaaagttgtctccggc
attttgctctcctctttctttttgctttctttagtctttgtgatcctcaaccagtcttca
gatttatcacaagaaaactcccgctcgtcggagactttgacgccggcgttgtcacgaggt
gtatctcagggagtttccgagaagactttcaaggatgtttccggtagaagcctttcgtac
tacccgtggactaatgctatgcttacttggcaaaggactgcttaccattttcaacctcaa
aagaattggatgaacgatcctaatggtccattataccacaaaggatggtaccatcttttt
tatcaatacaatcctgattcagctatttggggaaatatcacatggggccatgcaatatcc
acggacttgatccactggctttacttgcctttcgccatggttcctgatcagtggtacgat
atcaacggtgtctggaccgggtccgcgaccatcttgcccgacggtcagatcatgatgcta
tacaccggtgataccaatgattacgtgcaggtgcaaaatcttgcataccctgctaactta
tcggatcctctcctcatcgactgggtcaagtaccaggacaatccggtcatggttccccca
cccggcattggtgtcaaggacttcagagacccgacaactgcttggaccggaccccaaaac
gggcagtggctgctaaccatcgggtccaagattggtaaaacgggtattgcacttgtttat
gatacgtccaacttcacaaactttaagctattggatggagttttgcatgcggttccgggt
acgggtatgtgggagtgtgtggacttttacccggtatcaaccgttgaggcaaacgggttg
gacacatcatataacgggccaggtataaagcatgtgttaaaagcaagtttagatgacgat
aagcatgattactatgctattgggacatatgacccggtaaagaacaaatggactcctgat
aacccggaattggatgtgggtatcgggttgagactggactacgggaaatactatgcgtca
aagacattttatgacccgaaagaacaaagaagaatattgtggggatggattggagaaact
gacagtgaagctgctgatctgctgaagggatgggcatctgtacagagtattccaaggact
gtgctttatgacaaggagacaaggacacatgtacttcagtggccagttaaagaaattgag
agcttaagaattggtgatcctctagtgaaacaggtcaatcttcaaccaggctcaattgag
cttgtccatgttgactcagccgcacagttggatgtagaagcctcatttgaagtggacaaa
gcagcactcgcgggaacaattgaagcagatgtaggtttcaactgcagtactagtggaggt
gctgctaaaagaggcattttgggaccatttggtgtcgttgtaattgctgatcaaacgctt
tctgagctaaccccagtttacttctacattgccaaaggaactggtggccgagctgaaacc
tacttctgcgctgatgaaactagatcctcagaggctcctggagttgctaaacaagtgtat
ggtagttcagtaccagtgttagatggtgaacaacactcaatgagattattggtggaccac
tcaattgtggaaagctttgctcaaggaggaagaacagtcataacatcgcgaatttaccca
acaaaagcaatcaatggagcagcacgactgttcgttttcaacaatgccaccggggctagt
gtgactgcctccctcaagatttggtcactcaaatcagctgatattcgatccttccccttg
gaccagttgtaa

DBGET integrated database retrieval system