KEGG   Nicotiana tabacum (common tobacco): 107773859Help
Entry
107773859         CDS       T04643                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107773859
   00500 Starch and sucrose metabolism
    107773859
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107773859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 107773859
NCBI-ProteinID: NP_001312099
UniProt: U3RGC4
Position
Un
AA seq 579 aa AA seqDB search
MEFFKKSSSLWDTFAISLVSFIVVFPNINGVFGSHKVYIDLQSSSAVNVKNVHRTGFHFQ
PPKHWINAPMYYNGIYHLFYQYNPKGSVWGNIVWAHSVSKDLINWIHLEPAIYPSKKFDK
YGTWSGSATILPSNKPIILYTGLVDSNKTQVQNYAVPANLSDPYLREWIKPDNNPLIVPD
ISINKTQFRDPTTAWMGKDGHWRIIMGSLRKKRGLAIMYRSKDFMRWIKAKHPLHSTANT
GNWECPDFFPVSLQGTNGLDKYGEDSKYVLKNSMDLTRFEYYTVGTYDIKKDRYIPDNTS
VDSWKGLRLDYGNFYASKSFYDPSKNRRVTWGWANESDIMPDDDIKKGWAGIQLIPRKLW
LDPSGKQLVQWPVEELETLRKQKFQLSNKKLNNGEMVEVKGITPAQADVEVTFSFASLDK
AEPFDPNWTDLYAQDVCAIKGSTVQGGLGPFGIATLASQNLEEYTPVFFRVFKAQQNYKV
LMCSDATRSTLKYNETMYKPSFAGYVDVDLADKKLSLRSLIDNSVVESFGAGGKTCITSR
VYPTLAIYDKAHLFAFNNGTEPITIETLDAWSMGNAKIE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggagttttttaagaaaagctcttctctttgggatacttttgcaatttccttagttagt
ttcattgtagtttttccgaatattaatggagtgtttggttcccacaaagtttatatagac
ttacaatcttcaagtgctgttaatgtcaaaaatgtccacagaactggtttccattttcaa
ccaccaaagcattggatcaatgctccaatgtattacaatggaatctatcatctattctat
caatacaatccaaaaggatcagtttggggtaatattgtttgggctcattcagtttcaaaa
gatttgattaattggattcatttagagcctgcaatttatccatctaaaaaatttgacaaa
tatggaacatggtctggatcagcaaccattctccctagtaacaagcccattattttatat
actggactagtagattccaataaaacccaagtccaaaattacgccgtccccgccaactta
tccgatccatatctccgtgaatggatcaagcccgataacaacccgttaatcgtccccgat
atcagtatcaacaagacccaatttcgcgacccgacaacagcttggatgggcaaagatggt
cattggagaattataatgggaagtttgagaaaaaagaggggattggcaataatgtataga
agtaaggattttatgagatggattaaggctaaacatccacttcattcaactgctaataca
ggaaattgggaatgtcctgattttttccctgtatcattacaaggtacaaatggtttagat
aaatatggtgaagattctaagtacgtacttaaaaatagtatggatcttactaggtttgag
tactatactgttggtacgtacgatattaaaaaagacaggtatattccagataacacttcg
gttgatagttggaagggattgagacttgactatggaaatttctacgcatctaaatcattt
tatgatcctagcaagaatcgaagagttacttggggttgggctaacgaatcggatattatg
cccgatgatgatattaaaaaaggatgggctggaattcaactaattccacgtaaattatgg
ctcgaccctagtggtaaacaattggttcaatggcctgtcgaagaattagaaactctaaga
aaacaaaagttccaattgagcaacaagaagttgaacaatggagaaatggttgaggttaaa
ggaatcacacctgcacaggctgatgttgaagtgacattctctttcgcaagtttggacaag
gcagagccatttgatcctaattggactgatctttatgcacaagatgtttgtgcaattaag
ggttcaactgttcaaggagggcttgggccatttggtattgcaacattggcttctcaaaac
ttggaagaatacacacctgttttctttagagttttcaaagcacaacaaaattacaaagtt
ctcatgtgctctgatgccacaaggtcaactcttaagtacaacgaaacaatgtataaacct
tcgtttgctggatatgtggatgtagatttagcagacaaaaagttgtctctcaggagtttg
attgataattcagtagtggagagttttggtgctggtggaaaaacatgcataacatcaaga
gtttatccaacattggcaatttatgacaaggcacatttatttgcctttaacaatggtacg
gagccaattacaattgagactctagatgcatggagtatgggtaatgctaagatagaataa

DBGET integrated database retrieval system