KEGG   Nicotiana tabacum (common tobacco): 107810155Help
Entry
107810155         CDS       T04643                                 

Definition
(RefSeq) acid beta-fructofuranosidase AIV-18-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    107810155
   00500 Starch and sucrose metabolism
    107810155
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107810155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 643 aa AA seqDB search
MATHHSHYDPENSTTHYTVLPDQPESAGAGRRKSLKVVSGILLSSFFLLSLVFVILNQSS
DLSQENSRSSETLTPALSRGVSQGVSEKTFKDVSGRSLSYYPWTNAMLTWQRTAYHFQPQ
KNWMNDPNGPLYHKGWYHLFYQYNPDSAVWGNITWGHAISTDLIHWLYLPFAMVPDQWYD
INGVWTGSATILPDGQIMMLYTGDTNDYVQVQNLAYPANLSDPLLIDWVKYQDNPVMVPP
PGIGVKDFRDPTTAWTGPQNGQWLLTIGSKIGKTGIALVYDTSNFTNFKLLDGVLHAVPG
TGMWECVDFYPVSTVEANGLDTSYNGPGIKHVLKASLDDDKHDYYAIGTYDPVKNKWTPD
NPELDVGIGLRLDYGKYYASKTFYDPKEQRRILWGWIGETDSEAADLLKGWASVQSIPRT
LLYDKETRTHVLQWPVKEIESLRIGDPLVKQVNLQPGSIELVHVDSAAQLDVEASFEVDK
AALAGTIEADVGFNCSTSGGAAKRGILGPFGVVVIADQTLSELTPVYFYIAKGTGGRAET
YFCADETRSSEAPGVAKQVYGSSVPVLDGEQHSMRLLVDHSIVESFAQGGRTVITSRIYP
TKAINGAARLFVFNNATGASVTASLKIWSLKSADIRSFPLDQL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccattcccattatgacccggaaaactccacgacccattacactgtccta
ccggatcaacccgaatccgccggcgccgggcgccggaagtctcttaaagttgtctccggc
attttgctctcctctttctttttgctttctttagtctttgtgatcctcaaccagtcttca
gatttatcacaagaaaactcccgctcgtcggagactttgacgccggcgttgtcacgaggt
gtatctcagggagtttccgagaagactttcaaggatgtttccggtagaagcctttcgtac
tacccgtggactaatgctatgcttacttggcaaaggactgcttaccattttcaacctcaa
aagaattggatgaacgatcctaatggtccattataccacaaaggatggtaccatcttttt
tatcaatacaatcctgattcagctgtttggggaaatatcacatggggccatgcaatatcc
acggacttgatccactggctttacttgcctttcgccatggttcctgatcaatggtacgat
atcaacggtgtctggaccgggtccgcgaccatcttgcccgacggtcagatcatgatgcta
tacaccggtgataccaatgattacgtgcaggtgcaaaatcttgcataccctgctaactta
tcggatcctctcctcatcgactgggtcaagtaccaggacaatccggtcatggttccccca
cccggcattggtgtcaaggacttcagagacccgacaactgcttggaccggaccccaaaac
gggcagtggctgctaaccatcgggtccaagattggtaaaacgggtattgcacttgtttat
gatacgtccaacttcacaaactttaagctattggatggagttttgcatgcggttccgggt
acgggtatgtgggagtgtgtggacttttacccggtatcaaccgttgaggcaaacgggttg
gacacatcatataacgggccaggtataaagcatgtgttaaaagcaagtttagatgacgat
aagcatgattactatgctattgggacatatgacccggtaaagaacaaatggactcctgat
aacccggaattggatgtgggtatcgggttgagactggactacgggaaatactatgcgtca
aagacattttatgacccgaaagaacaaagaagaatattgtggggatggattggagaaact
gacagtgaagctgctgatctgctgaagggatgggcatctgtacagagtattccaaggact
ctgctttatgacaaggagacaaggacacatgtacttcagtggccagttaaagaaattgag
agcttaagaattggtgatcctctagtgaaacaggtcaatcttcaaccaggctcaattgag
cttgtccatgttgactcagccgcacagttggatgtagaagcctcatttgaagtggacaaa
gcagcactcgcgggaacaattgaagcagatgtaggtttcaactgcagtactagtggaggt
gctgctaaaagaggcattttgggaccatttggtgtcgttgtaattgctgatcaaacgctt
tctgagctaaccccagtttacttctacattgccaaaggaactggtggccgagctgaaacc
tacttctgcgctgatgaaactagatcctcagaggctcctggagttgctaaacaagtgtat
ggtagttcagtaccagtgttagatggtgaacaacactcaatgagattattggtggaccac
tcaattgtggaaagctttgctcaaggaggaagaacagtcataacatcgcgaatttaccca
acaaaagcaatcaatggagcagcacgactgttcgttttcaacaatgccaccggggctagt
gtgactgcctccctcaagatttggtcactcaaatcagctgatattcgatccttccccttg
gaccagttgtaa

DBGET integrated database retrieval system