KEGG   Natranaerobius thermophilus: Nther_0008Help
Entry
Nther_0008        CDS       T00761                                 

Definition
DNA gyrase subunit A (EC:5.99.1.3)
Orthology
K02469  
DNA gyrase subunit A [EC:5.99.1.3]
Organism
nth  Natranaerobius thermophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7594..10017
Genome map
AA seq 807 aa AA seqDB search
MSDTMRGKVVPIDIQEEMENSFLDYAMSVIVSRALPDVRDGLKPVHRRILFAMHDLGITP
EKPYKKSARVVGEVLGKYHPHGDVALYDAMVRMAQDFSTRYPLVDGHGNFGSVDGDSAAA
MRYTEVRMAKISTELLKDIDKETIDYQQNFDETLEEPVVLPSRFPNLLVNGSAGIAVGMA
TNIPPHNLDEVIDGIVAMIENPEIADEDLMNYIKGPDFPTGGIILGRNGIKDAYSTGRGK
LKIRAKTEIENLKGNKHRILVTEIPYQVNKAKLIESIASLVREKKIEGISDLRDESDRDG
LRVVIELKRDVNPNVLLNQLYKYTTLEQSFGIILLALVNGEPKVLSLREILDHYLEFQKE
VIIRRTKYLLRKAEARAHILEGLKIALNNLDAVIKLIRQSKTVKEAKEGLMNNFSLSDKQ
AQAILDMRLQKLTALERDKIEEEYSELLKKIDYYNRVLGDEQLVLNIIKEEIQEIKEKYS
DSRRTLITNKTDELDEEDLIPDEEVIITLTHQGYVKRVPLSTYRNQKRGGRGISGMTTKN
DDFVEHLFATSTHNYILFFTNKGKVYRLKVYEIPEASRQARGTAIVNLLAIDPDEHITAV
IPIQEFTEDDYLFFVTKQGVAKKVILSELKAYRKDGLIAINLNEDDELIDVHLTDGKQEI
ILGTEQGLAIKFSEEEVRSMGRNSRGVKGISLKDNDRVIGMDIAQENSDLLIVSENGYGK
RTPVSEYRTQSRGGKGIYTFKPSEKSGNLAGCIVVNEDEEIILVTAQGVINRQQVEGISQ
MSRRTQGVRLIKLKDDDQVVSLAIPES
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatactatgcgagggaaagtagtgccgattgatatccaagaagagatggaaaat
tcttttcttgattatgctatgagcgtaattgtcagtagggccttacctgatgtccgggat
ggtttaaaaccggttcatcgtcgaattttatttgctatgcacgatctaggaatcacacca
gaaaaaccttataaaaaatctgcccgtgttgttggagaagtgctaggtaaatatcatcct
catggtgatgtagcactttacgatgctatggtacgcatggctcaagacttttcaacccga
tatcctttggtggatggtcacggcaactttgggtcagttgacggtgatagtgctgctgcc
atgcgttacactgaagttcgaatggctaagatcagtacagaattattgaaggatatcgat
aaagaaactattgattatcaacaaaactttgacgaaactttagaggaacctgtcgtacta
ccttctagatttcctaacttacttgtcaatggttcagctggtatagcagttggtatggca
actaatattcctcctcacaatttagacgaggttatcgacgggatagtggccatgatagag
aatcctgagattgccgatgaggatttaatgaattatattaaaggtcccgattttcccact
ggaggaattatccttggcagaaatggaattaaagacgcttattcaactggaagaggaaaa
cttaaaattagagcaaaaacagaaattgaaaatttaaaaggaaataagcatagaatttta
gtaacagaaatcccttatcaggtaaataaagccaaacttatagaatcaattgcatcttta
gttagggaaaagaaaattgaaggaattagtgatctcagggatgaatctgatagagatggt
ctcagagttgtaatagaactcaagagggatgtaaatcctaatgtcctattaaatcagcta
tataaatacactactttagaacaatctttcggaattatcttactagccctggttaatgga
gagcccaaagtactttcgcttagagaaatcctggatcattatctggaatttcaaaaagaa
gttattatcagacgaaccaaatatttattgagaaaagccgaagcaagggctcatatttta
gaaggacttaagatagctttaaataatttagatgctgtgatcaaattgattagacaatct
aaaactgttaaagaggcaaaagaaggtcttatgaacaatttttcattatcagataaacaa
gcccaagcaattttagatatgagacttcaaaagctaactgctttggaacgagataaaata
gaggaagaatacagtgaactattaaagaagattgactactacaacagagtattaggggat
gaacaattagtcttaaatattattaaagaagaaatccaggaaataaaagagaaatacagt
gatagtagaagaactttaattactaataagaccgatgaacttgatgaagaagatttaatc
cctgatgaagaagtaattatcacattaacgcatcaaggatatgtcaaacgagtaccactg
tccacttaccgtaatcaaaaacggggtggtcgaggtattagtgggatgactactaaaaac
gatgattttgtagaacatctttttgcaacttcaactcataattatattttattctttacc
aataaaggcaaggtttatagacttaaagtatatgaaatcccggaagcttcacgacaagcc
agaggtacagctattgttaatctacttgcaatagatcctgatgaacacattactgcagtt
ataccgattcaagaatttactgaagatgactatctgtttttcgtaacgaagcagggagtt
gctaaaaaagttatcttaagcgaattaaaagcttatcgaaaagatggtttgattgcaata
aacttaaatgaagatgatgaattgattgatgttcatctaactgacggaaaacaagaaata
attttaggaacggagcaaggattagcaattaaattttcagaagaagaagttagaagtatg
ggaagaaattctcgcggtgtaaaaggtatttcattgaaagataatgatcgagtaattgga
atggatattgcccaagaaaattctgatttactaattgtcagtgaaaacggctatggaaag
aggactccagtttcagaatataggacacaatcaagaggcggaaaaggtatctataccttt
aaaccatcagaaaaatccgggaatctagcgggttgtatagtagttaatgaagatgaagaa
attatactggtgactgcacaaggtgtgattaacaggcagcaagttgaaggcatatcacaa
atgagtaggagaactcaaggagtgagattaattaaattaaaagatgacgatcaagtggta
tcactggcgattccagaaagttaa

DBGET integrated database retrieval system