KEGG   Natranaerobius thermophilus: Nther_0017Help
Entry
Nther_0017        CDS       T00761                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nth  Natranaerobius thermophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nther_0017
DNA repair and recombination proteins [BR:nth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Nther_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
28179..28778
Genome map
AA seq 199 aa AA seqDB search
MSNYPKPINRLIEALSYLPGIGPKTAERLAFHIVSMDETKVNHLITALQDSRDKVFECST
CNNLTDKDPCTICQDESRDSNLICVVQDARDVTAIEKVQDFQGKYHVLQGVISPMEGIGP
DDLNLKALMDRIQGEGITELVVATDPTVEGEATAMYLNKLVKPLGVRVTRLAYGLPMGGD
LEYADEMTLQQAFEGRKEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattatccgaaacctattaatcgcttaattgaagctctttcatatcttcccgga
attggacctaaaactgcagaacgactggcatttcatattgtttcaatggacgaaaccaaa
gtgaatcatttaattacagccctgcaggactctagagacaaagtttttgaatgcagcact
tgtaataatttaacagataaagatccttgtacaatttgtcaggatgaaagtcgtgatagt
aatttgatttgtgtagtgcaagatgccagagatgtgactgcaattgaaaaagttcaagat
tttcaaggaaagtatcatgtgctgcaaggagttatttctcctatggaaggtattggccct
gatgatttaaatttgaaggctttaatggatcggatccaaggagaaggaattactgaacta
gttgtagctaccgatcctactgttgaaggtgaagctacggctatgtatttaaataaactt
gtcaaaccattaggagtaagagttactcgattagcttatggactccctatggggggagat
ttagaatatgctgatgaaatgacattacaacaagcctttgaaggacgaaaagagttgtag

DBGET integrated database retrieval system