KEGG   Natranaerobius thermophilus: Nther_0056Help
Entry
Nther_0056        CDS       T00761                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nth  Natranaerobius thermophilus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nther_0056
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Nther_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
71216..72142
Genome map
AA seq 308 aa AA seqDB search
MSPDILRVESPAKINLYLDILGKRQDGFHEVEMVMQSISLCDRLTFIRQSQGNNNNIELL
MKSSDCIDQLPVRGDNLIIKAARLLMNDFRLPPIKVILEKNIPTEAGLAGGSSNAAATLW
AINHMFQLGLTEQELSDIGARLGSDIPFCLFGGTKLAKGRGEILHPLPSLPNCYFVLVKP
NFGVSTGKVYQELGFKTDTEYGENHQTKSRVNGIISGLEKGTLTGIVENMYNKMEEIVFK
WHRDMQIISQQIEQLGALKVLMSGSGSTIFGVFDNYDTAKYAKKQLEREFKYVFLSIPRD
MGVGKENN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccagatattttgagagtggaatctcctgctaagattaatctctacttagatatt
ttagggaagaggcaggatggtttccatgaagttgaaatggtaatgcaatcgatttcttta
tgtgatcggttaacttttataagacaatcccagggtaacaataacaatattgaattgcta
atgaaatcatcggactgtattgaccaattacctgtcaggggagataacttaataattaag
gctgccaggttattgatgaatgattttagattaccgccaatcaaggtgattttagagaag
aacattccaactgaagcggggttagccggtggcagtagtaatgctgctgcaactttatgg
gcaataaatcacatgtttcaactaggacttaccgagcaagaactatctgacataggtgct
cgccttggttcagatattcccttttgtttgtttggcggaaccaagcttgccaagggacga
ggagaaattttacatccactaccttctttgcccaactgttattttgtactagttaaaccc
aattttggagttagtacgggaaaagtgtatcaagagctagggtttaaaacggataccgaa
tatggagaaaatcatcaaacaaaatcaagggtcaatggaattatttcaggcttggaaaaa
ggaactttaactggaattgtagaaaatatgtataataagatggaagagattgtgtttaaa
tggcatagggatatgcaaataatatcacagcaaattgagcaattaggggctttaaaagta
ttaatgagtggaagtggttcaactatttttggcgtttttgataactatgacactgctaaa
tatgcaaaaaaacaattagaaagagaatttaagtatgtgtttctctcgatcccccgtgat
atgggagtgggaaaggagaataattaa

DBGET integrated database retrieval system