KEGG   Natranaerobius thermophilus: Nther_0056Help
Entry
Nther_0056        CDS       T00761                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nth  Natranaerobius thermophilus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:nth00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
71216..72142
Genome map
AA seq 308 aa AA seqDB search
MSPDILRVESPAKINLYLDILGKRQDGFHEVEMVMQSISLCDRLTFIRQSQGNNNNIELL
MKSSDCIDQLPVRGDNLIIKAARLLMNDFRLPPIKVILEKNIPTEAGLAGGSSNAAATLW
AINHMFQLGLTEQELSDIGARLGSDIPFCLFGGTKLAKGRGEILHPLPSLPNCYFVLVKP
NFGVSTGKVYQELGFKTDTEYGENHQTKSRVNGIISGLEKGTLTGIVENMYNKMEEIVFK
WHRDMQIISQQIEQLGALKVLMSGSGSTIFGVFDNYDTAKYAKKQLEREFKYVFLSIPRD
MGVGKENN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaccagatattttgagagtggaatctcctgctaagattaatctctacttagatatt
ttagggaagaggcaggatggtttccatgaagttgaaatggtaatgcaatcgatttcttta
tgtgatcggttaacttttataagacaatcccagggtaacaataacaatattgaattgcta
atgaaatcatcggactgtattgaccaattacctgtcaggggagataacttaataattaag
gctgccaggttattgatgaatgattttagattaccgccaatcaaggtgattttagagaag
aacattccaactgaagcggggttagccggtggcagtagtaatgctgctgcaactttatgg
gcaataaatcacatgtttcaactaggacttaccgagcaagaactatctgacataggtgct
cgccttggttcagatattcccttttgtttgtttggcggaaccaagcttgccaagggacga
ggagaaattttacatccactaccttctttgcccaactgttattttgtactagttaaaccc
aattttggagttagtacgggaaaagtgtatcaagagctagggtttaaaacggataccgaa
tatggagaaaatcatcaaacaaaatcaagggtcaatggaattatttcaggcttggaaaaa
ggaactttaactggaattgtagaaaatatgtataataagatggaagagattgtgtttaaa
tggcatagggatatgcaaataatatcacagcaaattgagcaattaggggctttaaaagta
ttaatgagtggaagtggttcaactatttttggcgtttttgataactatgacactgctaaa
tatgcaaaaaaacaattagaaagagaatttaagtatgtgtttctctcgatcccccgtgat
atgggagtgggaaaggagaataattaa

DBGET integrated database retrieval system