KEGG   Natranaerobius thermophilus: Nther_0168Help
Entry
Nther_0168        CDS       T00761                                 

Definition
glutamate--tRNA(Gln) ligase, glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
nth  Natranaerobius thermophilus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nth00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Nther_0168
Enzymes [BR:nth01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Nther_0168
Amino acid related enzymes [BR:nth01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Nther_0168
Transfer RNA biogenesis [BR:nth03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Nther_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
191302..192768
Genome map
AA seq 488 aa AA seqDB search
MTNKARLRFAPSPTGQIHIGNIRTALFNWLYSRHIDGEFILRVEDTDMNRSVEEYEQIIF
RALSWLGLDWDEGPQKGGDFGPYRQSERKDIYHKYANKLLEAGKAYYCYCTEEELEEMRE
AQRARGEMPRYSGKCADLSSEERAELENEGRKSVIRFKVPENQTIRVNDLVKGEVDFESD
GIGDFILIKSDDMASYNFACVVDDYLMNITHVLRGEDHLSNTPKQVMIYEALGFETPEFG
HLSLILGPDKAKLSKRHGDTFIGEYREKGYLPEAMVNFLALLGWSPPGEDELFTQDELIR
LFDIGRVSKSAAVFDVDKLNWMNSHYIKEADTERLLNLSKEYLINSDLVSQEQLEHDWEW
FVSAVDLVKEKIDMLSELPPQLKIFYGDDVDLKGEEVEFLEKDHVPELLSEVINQFNDLD
SFEDPKAIKKAVNKAGKQVGVKGKQLFMPVRIAVSGQMHGPELDQLISLLGRERAINRVN
STLSQIQS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ttgactaataaagcgaggttgcgatttgctccaagccctactggacagatccatatcggc
aacattcgtaccgcattatttaactggttgtactctagacatattgatggagaatttata
ttaagagtagaagatactgatatgaacagatcagttgaagaatacgaacagataatcttt
agagcgttaagttggctgggattagattgggatgaaggcccccaaaaaggtggagatttc
ggtccctacagacagagtgagagaaaagatatttatcacaaatatgccaataaattatta
gaagctggaaaggcttattattgctactgtaccgaagaagagctggaagagatgagagaa
gctcagagggctagaggtgaaatgcctagatatagcggcaaatgtgccgatctcagctcc
gaggaacgagcagaattagaaaatgaagggcgtaagtcagtgattagatttaaagttcca
gaaaatcagactattcgtgtaaacgatctggtaaaaggtgaagtagactttgaaagtgat
gggatcggagattttatattaataaaaagtgatgacatggcttcatataattttgcatgt
gtagttgatgattacttaatgaacattacccatgttttaaggggagaagatcacctttcc
aatactcccaaacaagtaatgatttatgaggctctgggctttgagactcctgaatttgga
catttatctttgattttaggtcctgataaagcaaaactaagtaaacgtcatggtgacacc
tttataggggaatatcgagaaaaaggttatctacctgaagcaatggtaaactttttagct
ttattaggttggtctccgcctggagaagatgaactttttacccaagatgaactaattaga
ttatttgatataggtagagtttcgaaaagtgccgcagtctttgatgtggataaattaaat
tggatgaactcacactatattaaagaggcggatacagaaagattgcttaacctttctaaa
gaatatttaattaattccgacctagtgtcgcaagaacagttagagcacgattgggaatgg
ttcgtttctgctgtggatttagtcaaggaaaaaattgatatgctatcggaattacctcca
cagttaaaaatcttttatggagacgatgtagaccttaaaggtgaggaagtagaattttta
gagaaggaccacgttcctgaattactttcagaagttattaatcaatttaatgatttagac
tcctttgaggatcctaaagctatcaagaaagcagttaataaagccggtaagcaggttggt
gtcaaaggtaagcagctttttatgcctgtaagaattgcagtgagtggacaaatgcacggc
cctgagcttgatcagctaatttctttattgggccgagaacgagcgattaatagagtgaat
agcactctttcacaaattcaaagttaa

DBGET integrated database retrieval system