KEGG   Natranaerobius thermophilus: Nther_0168Help
Entry
Nther_0168        CDS       T00761                                 

Definition
glutamate--tRNA(Gln) ligase, glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
nth  Natranaerobius thermophilus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:nth00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
191302..192768
Genome map
AA seq 488 aa AA seqDB search
MTNKARLRFAPSPTGQIHIGNIRTALFNWLYSRHIDGEFILRVEDTDMNRSVEEYEQIIF
RALSWLGLDWDEGPQKGGDFGPYRQSERKDIYHKYANKLLEAGKAYYCYCTEEELEEMRE
AQRARGEMPRYSGKCADLSSEERAELENEGRKSVIRFKVPENQTIRVNDLVKGEVDFESD
GIGDFILIKSDDMASYNFACVVDDYLMNITHVLRGEDHLSNTPKQVMIYEALGFETPEFG
HLSLILGPDKAKLSKRHGDTFIGEYREKGYLPEAMVNFLALLGWSPPGEDELFTQDELIR
LFDIGRVSKSAAVFDVDKLNWMNSHYIKEADTERLLNLSKEYLINSDLVSQEQLEHDWEW
FVSAVDLVKEKIDMLSELPPQLKIFYGDDVDLKGEEVEFLEKDHVPELLSEVINQFNDLD
SFEDPKAIKKAVNKAGKQVGVKGKQLFMPVRIAVSGQMHGPELDQLISLLGRERAINRVN
STLSQIQS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
ttgactaataaagcgaggttgcgatttgctccaagccctactggacagatccatatcggc
aacattcgtaccgcattatttaactggttgtactctagacatattgatggagaatttata
ttaagagtagaagatactgatatgaacagatcagttgaagaatacgaacagataatcttt
agagcgttaagttggctgggattagattgggatgaaggcccccaaaaaggtggagatttc
ggtccctacagacagagtgagagaaaagatatttatcacaaatatgccaataaattatta
gaagctggaaaggcttattattgctactgtaccgaagaagagctggaagagatgagagaa
gctcagagggctagaggtgaaatgcctagatatagcggcaaatgtgccgatctcagctcc
gaggaacgagcagaattagaaaatgaagggcgtaagtcagtgattagatttaaagttcca
gaaaatcagactattcgtgtaaacgatctggtaaaaggtgaagtagactttgaaagtgat
gggatcggagattttatattaataaaaagtgatgacatggcttcatataattttgcatgt
gtagttgatgattacttaatgaacattacccatgttttaaggggagaagatcacctttcc
aatactcccaaacaagtaatgatttatgaggctctgggctttgagactcctgaatttgga
catttatctttgattttaggtcctgataaagcaaaactaagtaaacgtcatggtgacacc
tttataggggaatatcgagaaaaaggttatctacctgaagcaatggtaaactttttagct
ttattaggttggtctccgcctggagaagatgaactttttacccaagatgaactaattaga
ttatttgatataggtagagtttcgaaaagtgccgcagtctttgatgtggataaattaaat
tggatgaactcacactatattaaagaggcggatacagaaagattgcttaacctttctaaa
gaatatttaattaattccgacctagtgtcgcaagaacagttagagcacgattgggaatgg
ttcgtttctgctgtggatttagtcaaggaaaaaattgatatgctatcggaattacctcca
cagttaaaaatcttttatggagacgatgtagaccttaaaggtgaggaagtagaattttta
gagaaggaccacgttcctgaattactttcagaagttattaatcaatttaatgatttagac
tcctttgaggatcctaaagctatcaagaaagcagttaataaagccggtaagcaggttggt
gtcaaaggtaagcagctttttatgcctgtaagaattgcagtgagtggacaaatgcacggc
cctgagcttgatcagctaatttctttattgggccgagaacgagcgattaatagagtgaat
agcactctttcacaaattcaaagttaa

DBGET integrated database retrieval system