KEGG   Natranaerobius thermophilus: Nther_0236Help
Entry
Nther_0236        CDS       T00761                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nth  Natranaerobius thermophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nth01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nth00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
245424..246317
Genome map
AA seq 297 aa AA seqDB search
MNTSIIGVPMDLGANRRGVDMGPSAIRYADLRAKLEEIGIDAKDKGNISVPLPEIDSMEA
EEIKYPKQIEAVTNSLALQVSKEASQNRIPIILGGDHSIAIGSIAGMKQAVGELGVLWFD
AHADLNTFETSPSGNIHGMPLAFSLGYGNSNLVNCLEKGQKIKPENTVLIGTRSIDEPEK
ELIEKSGVTVFTMYDLDKMGMNRVMEEALSIVTSNTDGVHVSLDMDALDPVEAPGVGTPV
RGGINYREVHLAMELIAEAQCINSMEVVEVNPILDSVNRTGDLAVELVASALGERVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatcaataattggagttcctatggatttaggagccaaccgtagaggagtagat
atgggtccaagtgcaatcaggtatgctgatttaagagcaaaactagaggaaattggaatt
gatgccaaagataaaggtaatatttctgttcctctgcctgaaatagacagcatggaagca
gaggaaattaagtatcccaaacaaattgaagctgttacaaattccctagcactgcaagtt
tcaaaagaagcaagccaaaatagaattcctattatacttggcggtgatcatagtatagca
attggtagtattgcaggtatgaaacaagccgttggagagctgggtgtattatggtttgat
gctcatgctgatttaaatacatttgaaacaagtccttcagggaatattcatggcatgccc
ttagccttttctttaggttatggaaacagcaacttggttaactgtctggaaaaaggtcag
aaaataaaacctgaaaatacagtattaattgggactagatctatagatgaaccggaaaaa
gaactaattgaaaaatctggtgtgactgtatttaccatgtacgatttggataaaatggga
atgaaccgtgtaatggaggaagcattgtcaattgtcacttccaatactgatggagttcac
gtgagtttagacatggatgcacttgacccggtagaagcgccaggagtaggtacccctgtc
cgaggtggaattaattaccgggaggtgcatttagccatggagctgatagcagaggcacaa
tgtataaactccatggaagtagtagaagttaatcctattttagacagtgtcaaccggacc
ggtgatttggctgtagagttagtagcttcggctttaggtgaacgtgtattataa

DBGET integrated database retrieval system