KEGG   Natranaerobius thermophilus: Nther_0236Help
Entry
Nther_0236        CDS       T00761                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00220  Arginine biosynthesis
nth00330  Arginine and proline metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01130  Biosynthesis of antibiotics
nth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Nther_0236
   00330 Arginine and proline metabolism
    Nther_0236
Enzymes [BR:nth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Nther_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACB83835
JGI: Nther0236
UniProt: B2A4R3
Position
245424..246317
Genome map
AA seq 297 aa AA seqDB search
MNTSIIGVPMDLGANRRGVDMGPSAIRYADLRAKLEEIGIDAKDKGNISVPLPEIDSMEA
EEIKYPKQIEAVTNSLALQVSKEASQNRIPIILGGDHSIAIGSIAGMKQAVGELGVLWFD
AHADLNTFETSPSGNIHGMPLAFSLGYGNSNLVNCLEKGQKIKPENTVLIGTRSIDEPEK
ELIEKSGVTVFTMYDLDKMGMNRVMEEALSIVTSNTDGVHVSLDMDALDPVEAPGVGTPV
RGGINYREVHLAMELIAEAQCINSMEVVEVNPILDSVNRTGDLAVELVASALGERVL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaatacatcaataattggagttcctatggatttaggagccaaccgtagaggagtagat
atgggtccaagtgcaatcaggtatgctgatttaagagcaaaactagaggaaattggaatt
gatgccaaagataaaggtaatatttctgttcctctgcctgaaatagacagcatggaagca
gaggaaattaagtatcccaaacaaattgaagctgttacaaattccctagcactgcaagtt
tcaaaagaagcaagccaaaatagaattcctattatacttggcggtgatcatagtatagca
attggtagtattgcaggtatgaaacaagccgttggagagctgggtgtattatggtttgat
gctcatgctgatttaaatacatttgaaacaagtccttcagggaatattcatggcatgccc
ttagccttttctttaggttatggaaacagcaacttggttaactgtctggaaaaaggtcag
aaaataaaacctgaaaatacagtattaattgggactagatctatagatgaaccggaaaaa
gaactaattgaaaaatctggtgtgactgtatttaccatgtacgatttggataaaatggga
atgaaccgtgtaatggaggaagcattgtcaattgtcacttccaatactgatggagttcac
gtgagtttagacatggatgcacttgacccggtagaagcgccaggagtaggtacccctgtc
cgaggtggaattaattaccgggaggtgcatttagccatggagctgatagcagaggcacaa
tgtataaactccatggaagtagtagaagttaatcctattttagacagtgtcaaccggacc
ggtgatttggctgtagagttagtagcttcggctttaggtgaacgtgtattataa

DBGET integrated database retrieval system