KEGG   Natranaerobius thermophilus: Nther_0313Help
Entry
Nther_0313        CDS       T00761                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
nth  Natranaerobius thermophilus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
329673..330701
Genome map
AA seq 342 aa AA seqDB search
MELLKKLTQTPGIPGREEPIAELIKEEMNQICDEVWVDPLGSVIGLKKGNGNKKVMVAGH
MDEIGFIVKHIDKNGFIRLQPVGGFDPRSLMAQRVIVHGKEDLIGNLAPATKPIHVLSPE
EKKKQLQVKDYFVDLGLSGEKVKELVEIGDPVTLKQDFEEIGNMYSSKSLDDRVGVYVML
EAAKQLKDHDADIYLVATSQEEVGIRGAMTSSYGIEPDVGIALDVTIAADTPGSEESEQV
TKLGEGAAIKIMDSASITNRKVLQTLKDLANEKDINHQMEILPKGGTDAGSIQRSKSGIP
VGTISIPCRYVHTVNEMIHKEDLDASVNLLSAFLAEANFNEF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagctattgaaaaaactcactcaaacacctggaataccgggaagagaggagcctatt
gcggaattaatcaaagaagaaatgaaccaaatttgcgatgaagtatgggtagatcccttg
ggaagtgtaataggacttaaaaaaggtaatggaaacaaaaaggtaatggttgctggtcac
atggatgagataggttttatagtaaagcatatcgataagaatggatttattcgcttacag
cctgtaggtggcttcgatccccgaagtttaatggctcaaagggtgattgttcatggaaag
gaagacttgattggcaatttagccccagctactaagccaattcatgtcttgagtcctgaa
gagaagaaaaaacaacttcaagtaaaggattattttgttgatttgggtctttctggtgaa
aaagtcaaggaattggtagaaatcggtgaccctgtcaccctaaaacaagattttgaagaa
atcgggaacatgtatagtagtaaatcccttgatgacagagtgggagtatatgtcatgtta
gaagctgcaaaacagcttaaggaccatgatgcagatatttatcttgtagctacctctcag
gaggaagtgggtattagaggagccatgacatcttcttatggcatcgagcctgatgtaggc
attgcccttgatgtgactatagcggcagatactccaggaagcgaggaatcagaacaggtt
accaaattaggtgaaggtgcagctattaaaattatggactctgctagcataactaataga
aaagtacttcagacattaaaagacctagccaatgaaaaagatattaatcatcaaatggaa
atactacctaaaggaggaaccgatgctggttcaatccagagaagcaaatctggaattcct
gtggggacaatatctataccatgcaggtatgtacatacagtcaatgaaatgatccataaa
gaggatttagatgcgtcagtaaacttactatctgctttccttgctgaagcaaattttaac
gaattttaa

DBGET integrated database retrieval system