KEGG   Natranaerobius thermophilus: Nther_0314Help
Entry
Nther_0314        CDS       T00761                                 

Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nth  Natranaerobius thermophilus
Brite
Enzymes [BR:nth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nther_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(330821..331453)
Genome map
AA seq 210 aa AA seqDB search
MKDKFSAQREKMVQKQLAKRDIEDPKVLDAFRKVPREEFITESKQHQAYGDHPLPIGHGQ
TISQPYIVAMMTQALEPSSHDIVLEVGTGSGYQTAILAELTKKVFSLERIPELSEQAGRI
LSKLGYQNIVLKISDDDNDLTIHEQKEFDKIIVTAAASQIPPELTQQLKEGGTLVIPVGE
LMFQELLVVTKHNGELRKKSLGGCRFVPLK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataagttttcagcacaaagagaaaaaatggtccaaaagcagttagccaaaagg
gatattgaagatcccaaagttttggatgcatttaggaaagttccccgggaagaatttata
acagagtctaagcagcatcaagcatacggggaccatcctttaccaataggtcatggtcaa
accatatcccaaccttatattgttgccatgatgacacaagctttagaaccaagttctcat
gacatagtcttagaagtaggtacaggttctggttaccaaacggctattttagctgagcta
accaaaaaagtattttcccttgaaagaattcctgagttaagtgaacaggctgggcgtatt
ctatctaaactaggttatcaaaatattgttttaaaaatatctgatgatgacaacgatcta
acaattcatgaacaaaaagaatttgataaaataatcgtaactgcagctgcctcccaaatt
cctcctgaattaacacaacagttaaaagaaggaggaaccctggtgataccagtaggagaa
cttatgtttcaagaactactagtggtcactaaacataatggagaattaaggaagaaaagt
ttagggggatgcaggtttgttccattaaagtaa

DBGET integrated database retrieval system