KEGG   Natranaerobius thermophilus: Nther_0365Help
Entry
Nther_0365        CDS       T00761                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nth  Natranaerobius thermophilus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
381686..384622
Genome map
AA seq 978 aa AA seqDB search
MKLQFNPNLDFQQEAIRSIVDIFEGQPITHSNFTVANLSGQIGIHETNIGVGNKLDPSFD
EEDILKNVRKIQLRNGLPQTENIEKDDYHFTVEMETGTGKTYVYLRTLFELNQKYGFKKF
IIVVPSVAIKEGVVKSINIMSDHFKLLYDNVMFRAYEYQSQNIERIRDFATSDHIQIMVM
TIQSFNKDKNVINNDHERTNGLKPIEFIRDTNPIVVIDEPQSTVSTKKAEDAVMSLNPLC
TLRYSATHRKKHNLMYKLDAVDAYQRQLVKQIEVASVTSKDYHNDAYLRLVSVDNSKTPI
TAKIEIDKRTKNGGIKRQSVQVKKGDDLFEKSGGREQYSGYIVSEIYAKEGSEYVDFTSR
KHIELGEVRGELDDEVIKRTQIRKTIEEHLEKELRLKQEGIKILSLFFIDRVSNYRYYDE
EGNPQKGKYAIWFEEEYKDIIQKPKYRTLFNDVDIETEAEAVHNGYFSKDRKGKVKDTRG
NTQADEDTYNLIMKDKERLLDFNSKLKFIFSHSALKEGWDNPNVFQICTLNETKSEIKKR
QEIGRGLRLAVDQNGERRHGFNINTLTVMANESYEDFAKALQKEIEEEEGIKFGVVEKHT
FANLKVEREGEYQYLEQNASEELWNDLKSKEYIDDQGKITDKLKEDIKNKNFEVPEEYKE
VEDQVVATLKKIAGSLRINNADDKKEIKLNKQRYLSPEFKELWDRIKYKTTYNVEFDTEE
LIQECVEEIKKNLMIDKAKVIYTKGEVDISAAGTVAEEKGRYAMVVDDAKFRLPDIITYL
QNETSLTRKTIVRILKESGKLYQFKNNPQKFMDEVSKIIKTKMRHLIVDGIKYEKIGEEA
YYAQELFENEELFGYLSKNLVKSEKSVYDHVICDSDVEADFAQKFENNDLVKVYAKLPDW
FKIDTPLGDYNPDWAVLIDKDGEERLYFVVETKGSVLFEELRPREEGKIKCGEKHFEALG
NHIEFEKKDNFEEFIENV
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaatttaatcctaacttagactttcaacaagaggctattagatcaattgta
gatatatttgaaggacaacctattacgcattcaaactttactgttgctaatctatcagga
caaattggtattcatgaaacaaatataggggttgggaataaattagaccctagctttgat
gaagaagatatacttaaaaatgttagaaagattcaattaagaaatggattaccacagact
gaaaatatcgaaaaagatgactatcattttacagtagaaatggaaacgggaacgggtaag
acctatgtttatttgagaacgctatttgaacttaatcagaaatatggatttaagaaattt
attattgttgttccttcagttgctattaaagaaggtgtggttaaatctataaatattatg
tcagatcatttcaagctcttgtatgacaatgtgatgtttagagcttatgaatatcaatcc
caaaatattgaaagaatcagagactttgccactagtgaccatattcaaattatggttatg
actattcagtcttttaataaggataagaatgtcataaataacgaccatgaaaggactaat
ggattaaaaccaatagaatttatacgggatactaaccctattgtagtaatagatgaacct
cagtcaactgtttctaccaaaaaagcagaagatgcggttatgtctttaaatcctttgtgc
acattgagatattctgctactcacaggaagaaacataacttaatgtataaattagatgca
gtggatgcttatcaaagacagcttgtaaaacaaatcgaagtagctagtgtcacatcaaaa
gattaccataatgacgcttatttgcggttagtaagtgtagataatagtaagacaccaatt
acagcaaaaattgaaattgataagcggactaaaaacggagggattaaaagacaaagtgta
caagttaaaaaaggtgatgacttattcgaaaaatctggaggtcgtgaacagtatagtgga
tatattgtgagtgagatatatgctaaagaaggttctgaatatgttgattttacaagtcga
aaacatattgaattgggtgaagtcagaggtgagctagacgatgaagtaattaagcgtact
cagattaggaagaccattgaagagcatttggagaaagaattgagacttaaacaagaaggt
attaaaattttgagtctattctttatagatagagtttctaattacagatattacgatgaa
gaaggaaatccccagaaagggaaatacgctatttggtttgaagaggaatataaggatatt
attcaaaagccaaagtatagaacattgtttaatgacgttgatattgaaacggaagctgaa
gctgttcataacgggtatttttcaaaagatagaaagggtaaagtaaaagataccagaggt
aatacccaggctgatgaagatacttataacctgataatgaaagataaagagagattactt
gacttcaactcaaaactcaaatttatcttttcacattcagctctaaaagaaggttgggac
aaccccaatgttttccaaatttgcactttgaatgaaacaaaatctgaaataaagaaaaga
caagaaatcggtagaggacttaggttagcagtagatcaaaatggtgagagaagacatggc
tttaatataaacactctaactgtaatggctaatgaatcttatgaagactttgcaaaagct
cttcagaaagaaattgaggaagaagaaggcattaagtttggagtggttgaaaaacatact
tttgctaatttaaaagtcgagagagagggcgaatatcagtatctagaacaaaatgcttcc
gaagaattatggaatgatctgaaatctaaagaatatattgatgatcaaggcaaaattacc
gacaaattaaaagaagatataaaaaacaaaaatttcgaggtaccagaagaatataaagaa
gtagaggaccaggtagttgcaactcttaaaaagattgcaggaagtctgcgtatcaataac
gccgatgataagaaggaaatcaaattgaataagcaaaggtatttgagccctgaatttaaa
gaactttgggataggattaaatataaaactacttataatgttgaatttgatacggaagaa
ctgattcaagaatgtgtagaagagattaaaaagaacttaatgattgataaagctaaagtt
atatatacaaaaggagaagtagatattagtgcagcagggactgtagcggaagaaaaaggt
cgttatgctatggtagttgatgatgctaaatttagacttcctgatattataacttacctg
caaaatgaaactagccttacaagaaaaaccatagtacggatactaaaagaatcaggcaaa
ctttatcagtttaaaaataatcctcaaaaatttatggatgaagttagcaagattattaaa
acgaagatgagacatttaattgttgacgggataaaatatgaaaaaatcggtgaagaggct
tactatgctcaagagctatttgaaaatgaagaactttttggttatctttccaagaatctc
gtgaaaagtgaaaagtctgtttatgatcatgtgatttgtgattctgatgttgaagccgat
tttgcccaaaaatttgaaaataatgatctagttaaagtgtacgcaaagctccctgattgg
tttaaaatagacacaccgttaggagattataatcctgattgggcagtattaattgataag
gacggtgaagaaaggctctattttgtagttgaaactaaaggaagcgttttattcgaagaa
ttaagaccgagagaagaaggaaaaatcaaatgtggtgagaagcattttgaagcactagga
aatcacattgaatttgagaaaaaagataattttgaagagtttattgagaatgtttga

DBGET integrated database retrieval system