KEGG   Natranaerobius thermophilus: Nther_0444Help
Entry
Nther_0444        CDS       T00761                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nth  Natranaerobius thermophilus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nth00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
467489..468937
Genome map
AA seq 482 aa AA seqDB search
MSGIVALQGDLKDSEKLETMLSKLEHRGPDARETYTMADSFLGQVKSQGEPSFTKKRAAT
LVLDGQPSYLGKQISREELLNLYLEKGTKFIKQLGDAFTFILSDGDELVAARDTFGARPL
YYVNCENGLMFASEIKALEELNPDAEIKIFPPGTYYSSTEGFSTFKKIPGFQANIHASPG
SQRYNQKAEELNRLLIEAVRKNVTDQENIGVFLSGGVDSSIIAAALDKITDKPIKTFAVG
VAGSDDVMKARKVAEFLNSEHKEYTYDYDDMMKVLPEVIYYLESFDVELVNSSIANFLVA
YLAKESGMEVVLSGEGADELFGGYHHLKDCSTDSELNRELEHLLKGLHNGGLQRVDRMTK
AHALDCRMPFFDKDVIDFARVIPCNWKITDEGMEKLILRQAFDGMLPEEVLWRKKVQFGI
GSGNEGVMEEKIKNQITDKEYRNAQKNTSFTFKSKIEYYYYKIFKEKHPLKGIESTVNRW
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtattgtagctttacaaggtgatttgaaagattctgagaagttagagaccatg
ttgagtaaattagaacacagagggcctgatgctagggaaacttataccatggccgattct
ttcctaggacaggtcaaaagccaaggggagccttcttttacaaaaaaaagagcagccacc
ctggttttagatggtcagccaagttatctagggaaacaaatcagcagagaagagctgtta
aatctttatctagaaaaaggtaccaagtttatcaaacaattgggtgatgcctttaccttt
attctttcagatggagatgaactagtggctgcaagggacacctttggtgctaggccgtta
tactatgtaaactgtgaaaatggcttaatgtttgcttcagaaattaaagctttagaagag
ttgaacccggatgcagaaatcaaaatctttccaccagggacttactattcttcaactgag
ggtttctcaacttttaaaaagatacctggtttccaagcaaatatacacgcttctccagga
agccagcgctataaccagaaagctgaagaattaaatagattacttattgaagcagttaga
aaaaatgtaacagatcaagagaatattggtgtatttctaagcgggggagtagatagctcc
attattgcagcggcccttgataagattactgataaaccaattaaaacttttgcagttggt
gttgcaggtagcgatgatgtgatgaaagcccgtaaagttgccgaatttttaaatagcgag
cataaagaatacacatatgattatgacgacatgatgaaagtgcttccggaagtaatatat
tatctagaatcctttgatgtagaattggtcaatagttcaattgccaattttctagttgca
tacttagctaaggaatccggaatggaagtagtgctgtcaggggaaggagcggatgaactc
tttggtgggtatcaccatcttaaggattgttcaacggacagtgaattgaacagggaattg
gaacatttgttgaagggacttcacaatggagggctacagcgggtagatagaatgacaaag
gcccatgctttagactgtcgtatgcctttttttgataaagatgttatagattttgctagg
gtgataccctgtaactggaaaattactgatgaaggtatggaaaaactcattttaaggcag
gcctttgatggcatgttaccagaagaggtactatggcgtaaaaaagtacaatttggaata
ggatctggcaatgaaggtgttatggaggagaagattaaaaaccaaattacagataaggaa
tatagaaatgcccagaagaatacgagctttacttttaaatctaaaatcgaatattactat
tataaaatctttaaagaaaaacatccattaaaaggaatagaaagtaccgttaatagatgg
cttgcgtag

DBGET integrated database retrieval system