KEGG   Natranaerobius thermophilus: Nther_0557Help
Entry
Nther_0557        CDS       T00761                                 

Definition
putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nth  Natranaerobius thermophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(580017..583544)
Genome map
AA seq 1175 aa AA seqDB search
METPIKLFHDSHNPLYRKPFGAVSINKEILLRLYIRTTNPKELQVLANCIDDQGNKVAYP
MYQTGISENDCDQIDYDNGNGSIYKEELTGYFYEASIKSPDTPGLFWYTFTVVSNETKVY
FGNNQELSGGPGQESHQEPLGYQVTVHEQDLQIPNWLKDAVIYQIFIDRFNNGNEDGTVS
NPKRNSFLHSHWDNSPLYVRDQEGKILRWDFFGGNLEGVRQKLVYLKKLGVSIIYFNPIF
EAESNHRYDVGDYHKIDAMIGNNEEFRQFCKEAENMNIKVILDGVFSHTGSNSLYFNKYG
SYPSLGAYQSKESPYYNWYRFLEHPHKYESWWGIDNLPNVEEHNPDYQNFIISDDNSVLK
HWFRHGAKGWRLDVIDEIPDEFLQNFYQTLKSQDPESIVIGEVWEDASNKISYDRRRQYL
LGKELDSVTNYPLRNIMLDFVLDHNSSQETARRVLSLMENYPEDYFYTAMNLLGSHDVER
VLTVLKDNTPDDLREDLDSIAKKRLKLLTLWQMTFPGIPSIYYGDEAGLEGYQDPDNRKT
YPWGNEDQELVSWFRKLTAIRNHYDVLRTGDFSLVTTVSDSQQDLDKDILLYRRKISQNQ
DRFHQKRLNNTAVIVLNRNPRERKNLKIHISEVTGTNSGQSFVDPLEDYNIVSTDNDGYL
EITLEPLECKLLLADRYQGNANFERNAGILLHPTSLPSPYGIGDLGKEAYRFVDFLRDSG
QKFWQILPLNPPGYGNSPYQCFSAFAGNPLLISLDKLTEQGLLTQNRLSEAQQKQTNYVD
YEKTYQLKEPLLQAAFENFIDNGGKESHDFREFISQHSYWLEDYAMFMALKAHFNYKPWH
QWDDEEIIWRKPHALAKYREKLANTIDYHKFLQYIFFNQWHSLKNYTNKQNIHIIGDLPI
FVAHDSSDVWALKHYFELDSQGKPAKKAGVPPDYFSENGQLWGNPHYDWNELEQDNYRWW
IERIKVLMQLSDVVRIDHFRGFEAYWEIPGSEDTAVNGTWVKGPGEKFFNTIESNLQDKY
DPQIIAEDLGVITSEVEELKLKFDYPGMSILQFAIHNEPDHKFRVPLYNKNTVAYTGTHD
NDTIVGWLENELGERFSSQQEQINAAWKHIEMVYESDARSAIIPLQDFLGLNSNHRMNTP
GTIGDNWEWRFCWDQIGQELSDKINNLVYKTKRKP
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacacctattaagctgtttcatgactcccataatcctttgtatcgaaaaccattt
ggagcagtctctattaacaaagagatcttattaaggctttatattcgtactactaaccca
aaggaactgcaagtcttggctaattgcattgacgatcaaggtaacaaagtggcgtatccc
atgtatcaaactggaatttcggaaaatgactgcgatcaaattgactacgataatggcaat
ggtagtatttataaagaagaacttacagggtatttttatgaagcatccatcaaatcacct
gatacaccaggattattttggtatacttttacagtcgtaagtaatgaaactaaagtttat
ttcggtaacaatcaggaattatcaggaggcccaggccaagaaagtcaccaagaaccttta
ggttatcaagtaactgttcacgagcaagatttacaaatacccaattggctaaaagatgct
gtcatttatcaaatatttattgatagatttaataatggaaatgaagatggtacggtatct
aatcctaagagaaatagttttttacattcccactgggataattcgcctctgtatgttcga
gaccaagagggaaaaattttgcgatgggatttttttggaggaaatttagagggagtcagg
caaaaactggtttatctcaaaaaattaggtgtttccattatctattttaatcctattttc
gaagcggaaagcaatcatagatatgatgtaggtgactatcacaaaattgatgcgatgata
ggaaacaatgaggaatttcgtcaattttgcaaagaagctgaaaacatgaacattaaggtt
atcttagacggtgtctttagtcacacgggaagtaatagcctttattttaacaaatatgga
agctatccatcattaggggcatatcaatctaaagaatctccttattataattggtaccgc
tttttagaacatcctcacaaatacgaaagttggtggggaattgacaatctcccaaatgta
gaagaacataatcctgattatcaaaactttattattagtgatgacaacagtgttttaaag
cactggttccggcacggtgcaaagggatggagattagatgtaattgatgaaatccctgat
gagtttttacaaaatttctatcagactttaaaatctcaagatccagaaagtattgttatt
ggagaagtgtgggaagatgcctccaataaaattagttacgacaggcggaggcaatattta
ttgggaaaagagttggattcagtcacaaattatcctttaagaaacataatgctggatttt
gtattagatcataacagctctcaagagactgctcgaagagttttgtccctcatggaaaat
taccctgaagattatttttacacagccatgaatttactcggaagtcatgatgtcgaaagg
gttttgactgtcttaaaagacaatactcctgatgatttaagagaagatttggacagtata
gctaaaaaacgtctcaagttgttgactctctggcagatgactttccctgggataccttca
atttattacggagacgaagcaggattagagggctatcaagaccctgacaatcgaaagact
tatccctggggcaatgaggatcaggaattggtttcatggtttagaaaattaacagctata
agaaaccactacgatgtattacgaactggcgatttttccctggtcactacagtcagtgat
tctcaacaagatctggataaggacattttactgtatcgacgtaaaatttctcagaaccaa
gatagattccaccaaaaaagattaaacaatacagctgtaattgttctaaatagaaatccc
agagaacgaaagaatctaaaaattcatatctcagaagttactggcacgaatagtggtcaa
agctttgtagatcccttagaggattataacattgtttcgactgacaatgatggatatctt
gagatcaccttagaacctttagaatgcaagttactattagccgatagatatcaaggaaac
gcaaattttgaaaggaacgctggtattttacttcaccctacttcattaccttctccttat
ggaattggtgatttgggtaaagaagcctacagatttgttgattttctaagggactctggt
caaaaattttggcagattctccctctgaaccctccaggttacggaaattctccctatcag
tgcttttctgcttttgccggaaatcctttgttaataagcttagataagctgactgaacaa
gggctgcttactcagaatagacttagtgaagctcaacagaaacagactaactatgtcgac
tatgaaaagacttatcaattgaaagaacctttattacaagctgccttcgaaaatttcatt
gataatggtgggaaagaatcccatgattttagagagtttatctctcagcacagttactgg
ttagaagattacgctatgtttatggcattaaaagctcacttcaattataaaccttggcat
cagtgggacgatgaagaaattatctggagaaaaccacatgcactagcaaaatacagagaa
aaattagctaatactattgattatcacaaatttttgcagtatatatttttcaatcaatgg
cattcattaaaaaactataccaacaaacaaaatatacatattattggtgaccttcccatt
ttcgtggctcatgatagcagtgatgtttgggcactaaaacattactttgagttggattcc
caaggtaaaccggcaaaaaaggctggagtaccaccagattactttagtgaaaatggacaa
ttgtggggcaatcctcattacgactggaacgaactagaacaagataattacaggtggtgg
attgaacgaattaaagtcctaatgcagttatccgatgtagtacgcattgaccattttaga
ggttttgaagcttattgggaaatacctggttcagaagacacggcagtaaatggcacatgg
gtgaaaggacccggagaaaagttttttaataccatagaaagtaatctccaggataagtat
gacccgcaaataattgccgaggatctaggagtaattacctcagaagtagaggaacttaaa
ttaaaatttgattatcctggtatgagtattttacaatttgcaatccataacgagccagat
cacaaattcagagtccccttgtacaacaaaaatactgtagcctacactggaactcacgac
aatgacactatagtaggttggcttgaaaatgaattgggtgagagattttcttcccaacaa
gaacaaatcaatgccgcctggaaacacatcgaaatggtatatgaaagtgatgcccgctca
gcaattattcctttacaagattttttaggattaaatagtaatcacagaatgaatactcca
ggaaccattggtgataattgggaatggcgtttttgctgggatcaaattgggcaagagctt
tctgataaaattaataatttggtttataaaactaaaagaaaaccgtaa

DBGET integrated database retrieval system