KEGG   Natranaerobius thermophilus: Nther_0562Help
Entry
Nther_0562        CDS       T00761                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nth  Natranaerobius thermophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nther_0562
Enzymes [BR:nth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nther_0562
Exosome [BR:nth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nther_0562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(589798..591714)
Genome map
AA seq 638 aa AA seqDB search
MVQTKTITEFETHLFHEGTYFESYRKFGAHLSNEKGTVGTRFTVWAPNAKKIEIVGSFND
WHGEQYAMNKITTSGIWSLFIPEVTEGELYKYKIYPEGGGEPLLKADPYAFYSEKRPKSA
SIVYSLEGYNWGDREWQRKKRRENILKKPVSIYEVHLGSWKKTEDGDFLSYRELAHDLVD
YVKEMGYTHIELLPVVEHPFDRSWGYQATGYFSVTSRYGTPKDFMYFVDRCHQEGIGVIL
DWNPCHFCRDGHGLRLFDGAPVFEYQDPHRAENTEWDTNNFDLGKPEVISFLVSNAFFWF
DLFHIDGLRVDAVSSILYMDYGKEDGEEWLPNKYGGRENLEGLNFLRTLNEAVFERFPNV
MMVAEESTSWPLVSKPTYSGGLGFNFKWNMGWMNDMLEYMKKDPIHRKHHHQNITFSFLY
AFSENFVLPLSHDEVVHSKRSLLNKMPGDYWQKFANLRVLLGYQMGHPGKKLLFMGGELG
QFDEWKDLEQLDWNLLQFEFHWKMRQYCRQLNQLYTTEPALYEQDHTSKGFEWIDPHDHS
QSIISFIRWGYNFQDHLIIVCNFTPQVYHGYRIGVPKDVSYKEIFNSDAEEYGGSGILNS
DELQPHEVEWHHRPYSIELNIPPLATFILKPLAAREEN
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
ttggttcaaaccaagacaattactgaatttgaaactcatctttttcatgaaggcacatat
ttcgaaagctatcgtaaatttggagctcacttaagtaatgagaaaggaactgttggtact
cgatttactgtctgggcacctaatgccaagaaaattgaaattgtaggcagtttcaacgac
tggcatggtgaacaatacgcaatgaataaaatcacaacttcgggaatttggtcattattt
ataccagaagttactgaaggagaattatataagtataaaatttatcctgaggggggagga
gaacccctattgaaagctgatccctatgctttctattctgaaaaaagaccaaaatcagca
tccatcgtttattctctagagggatataactggggagatagggaatggcaacgaaaaaag
agacgagagaatattttaaaaaaacctgtatccatttacgaagtacacttaggtagctgg
aaaaaaactgaagatggagattttttatcttatcgtgaattagcccacgatttagtcgat
tatgtaaaagaaatgggctacactcatatagagctcctcccagttgttgaacatcctttt
gaccgttcgtggggttatcaggccactgggtatttttctgtcaccagccgttatggtacc
ccgaaggattttatgtattttgtagatcggtgtcatcaagaaggtatcggggtaattctg
gattggaacccctgtcatttctgtagagatggtcacggtttgagactctttgatggagca
ccggtttttgaatatcaagatccccacagggctgaaaatactgaatgggatactaataac
ttcgatcttgggaaaccagaagttatcagtttcttagtttctaatgcttttttctggttt
gacctttttcatattgatggtcttagagtagacgctgtctcaagtattttgtatatggat
tacggtaaagaagatggtgaagaatggttaccgaataaatacggaggcagagaaaattta
gaaggattaaattttctcaggacattaaacgaagctgtttttgaacggttccctaatgta
atgatggttgcagaagaatctacttcttggcccttagtcagtaaacctacatattcaggt
gggctaggttttaacttcaaatggaatatgggttggatgaatgacatgttagagtacatg
aaaaaagacccaatacaccgaaaacatcaccaccaaaatatcacattttctttcttatac
gctttttccgaaaatttcgttttgccattgtcccatgacgaggtagttcatagtaaaagg
tctcttctcaataaaatgcccggtgattattggcaaaagtttgccaatttaagagtatta
ctaggatatcaaatgggtcacccaggaaaaaaactattattcatgggtggagaactgggg
caatttgatgaatggaaagacttagagcaattggactggaacctattacaatttgaattt
cattggaagatgaggcagtactgtcgtcagttaaatcaactttacacaacagaaccagct
ctctacgaacaagatcatacatctaaaggttttgagtggatagatcctcatgatcacagt
caaagtattatcagttttattagatgggggtataatttccaggatcatttaattatagta
tgtaattttacgcctcaagtatatcacggttacaggattggagttcccaaagatgtgagt
tataaagaaatatttaacagtgacgctgaggagtatggtggttccggcatcttaaactca
gatgaactgcaaccccatgaggttgaatggcatcatcgcccgtattccattgaacttaat
atccctcccctggccacctttattttaaaacctttggcagctagagaggagaattag

DBGET integrated database retrieval system