KEGG   Natranaerobius thermophilus: Nther_0628Help
Entry
Nther_0628        CDS       T00761                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
nth  Natranaerobius thermophilus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Nther_0628
Enzymes [BR:nth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Nther_0628
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Nther_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
652115..653029
Genome map
AA seq 304 aa AA seqDB search
MKVAKLIGLDKTPDIKPGHDLAQIISENMVKESLELVSGDIVVISSKIVSKAENRIIDLN
YVSPGKKAKSLSQLTGKDAARIQVILEEAEQVVGYLSLKKLVQDRGFVESYFGNEDAHKM
LQNNEAVLFTVMPSGQLMTDGGTDFSNVKGKRVLSLLPRKPMESAEEIRTQLESIWNCSL
GVVVSDSEIRALRQGTADIAIGYSGITPLEQGFGKQDLYGEPTFGGVDSICDQIANSAAL
LMGQRDENVPVVILKGLANFQENYVKIDSKPELPYSYMARFIKEVAISRFKLYTWPLLAL
LRND
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttgcgaaattaattggtctagacaaaacacctgatattaaaccaggtcacgat
ttagcgcaaattatatcagaaaatatggtaaaagaaagtttagaattagtttctggagac
atagttgtaatcagcagtaaaatagtttccaaggcagaaaatcgaataatagatctcaac
tatgtttcacctggtaaaaaggctaaatccctttcccaattgacggggaaagatgctgcc
cgaattcaagtgatccttgaagaagcagagcaagtggttggttatctgtcactaaaaaag
cttgttcaggaccgaggttttgttgaatcttattttgggaatgaagatgcccacaaaatg
ttacagaataatgaagctgtactctttaccgttatgcccagtggacaattgatgacagat
ggaggaacagatttttccaatgtaaaaggaaaaagagtattgtctttgctccctcgcaag
cccatggaaagcgctgaggaaattcgaacacaacttgaaagcatttggaattgttcacta
ggggtggtggtttctgattcagagattagagctcttcgtcaaggaactgcagatatagca
attggttatagtgggataactcctttagagcaaggctttggcaaacaagatttatatggt
gaacctacatttggtggggttgattccatctgtgaccaaatagcaaatagtgcggctttg
ttgatgggacagcgggatgagaatgtaccggttgtcatacttaaaggactggccaatttt
caagaaaattatgttaaaatagatagcaaaccagaattaccatatagttacatggccaga
ttcattaaagaagttgccatatccaggttcaaattatatacttggcctttactagctttg
ttgagaaatgactag

DBGET integrated database retrieval system