KEGG   Natranaerobius thermophilus: Nther_0720Help
Entry
Nther_0720        CDS       T00761                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nth  Natranaerobius thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nther_0720
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nther_0720
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nther_0720
Enzymes [BR:nth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nther_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
744123..745298
Genome map
AA seq 391 aa AA seqDB search
MTKIGFYGEFGGQHVDEALKPSLEELTEFYYKYKDDSDFYKEFEYHLHTFGGRPTPLYYA
KNLTEKLGGGKIFLKREDLNHLGAHKLNNTIGQILLAQKMGKQEIVAETGAGQHGVATAA
VSAKFGFNCTIFMGALDAKKQPLNVFRMELLGAKVIKVESGNQTLNDAVNEALSYWVENL
ENTHYLLGSCVGPHPYPTIVRDYQSVIGREAKVQINELEGKNPDHIVACVGGGSNAIGLF
SAFIDNSEVKIHGVEAGGKSLTKGDHAATLTQGEPGMLHGAYTYYLKGEGDAPHDTHSIS
SGLDYPGVGPEHSHLKASGRASYVAVTDQEALEAYRDLAFCEGIVPALESSHALAYLNKL
APNTDKDELIIVNLSGRGDKDVEAVAKHTGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaataggtttttacggagaatttggcggtcagcatgttgatgaagccctgaag
ccttctttagaggaactaacagagttttattataaatacaaagacgactctgatttctat
aaggagtttgaataccacttgcacacctttggtggacgtcctactcctttatattatgct
aagaatttaacggaaaagcttggaggagggaagatctttttaaaacgtgaagatctaaac
cacttaggtgctcataaattaaacaatacaattggacaaattcttctcgcccaaaaaatg
gggaaacaggaaatagtagcagaaacaggagcgggtcagcatggagtggccacagcagca
gtctctgctaaatttgggtttaattgtactatttttatgggagcattagatgccaaaaaa
cagccattaaatgtatttcgaatggaacttttgggagctaaagtcataaaagtagaatcg
ggaaatcaaactttaaatgacgccgttaatgaagccctttcatactgggttgaaaacctt
gaaaatacccattatctcttgggttcatgtgttgggccacatccataccctacaatagtc
agggattatcaatctgtgattggccgggaagctaaagtccagattaatgaacttgaaggt
aagaatcccgaccacattgtagcttgtgtcggaggcggtagtaatgccatcggtttattc
tctgcttttattgataattcggaagtgaaaatacatggcgtagaagctggaggtaaaagt
ttaacaaagggcgatcatgcagctactttgacacaaggtgaaccgggaatgcttcatgga
gcttacacctattatctaaaaggggaaggagatgctccccatgatacacattccatatca
tcgggtttggattatcccggggtaggtcccgaacattcacatcttaaagcttcaggtagg
gcctcctacgtagccgttactgatcaggaagccctagaagcttacagggatctggctttc
tgtgaaggcattgtaccagctttggaaagtagtcatgcactagcgtatttaaataaactt
gcacctaatactgacaaagatgaactgataatagttaatttatcgggtcgcggtgacaag
gacgtggaagccgtagccaagcacacaggtctataa

DBGET integrated database retrieval system