KEGG   Natranaerobius thermophilus: Nther_0827Help
Entry
Nther_0827        CDS       T00761                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00030  Pentose phosphate pathway
nth01100  Metabolic pathways
nth01120  Microbial metabolism in diverse environments
nth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nther_0827
Enzymes [BR:nth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Nther_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACB84412
JGI: Nther0827
UniProt: B2A7W4
Position
complement(863567..865300)
Genome map
AA seq 577 aa AA seqDB search
MNNIFRVNLSERSVNQVEVPESYQALGGRALTSQIIYDEVKPTSHPLGENNKLVFAPGLL
SGTRAPSSGRLSVGSISPLTKGIKESNSGGTAAQDLAKLGLKALVIEGKAEQDNQVLVID
KDGVRLEEDNSLAGLGNYEVGDKLRQKYGEKVTIMSIGPAGEYKMTAASIAVTDTDDRPV
RAFGRGGLGAVMGAKGLKAIVIDDEGAPGVELTDEDAFKEASRKFSKIILDHPVSGEALR
NYGTAVLINILNEAGGLPTENFRSGRFETANKISGETMTETIKERDGKPGHSCHPGCIMG
CSNVYHDDKGEYLTAGFEYETIWAFGAHCNIDDLDYIAYFDRCCDDLGLDTIETGVTFGV
FMETDMIEFGDKEEVKRIFDEEIRKGTPLGQILGSGSETTGRVFGIDRVPTVKRQSIPAY
DPRAVKGVGVTYATSTQGADHTAGYSVTANILKVGGEINPLKKEGQVDLSRDLQVATASI
DSTGLCLFVAFAVLDSDEALPTVVDMINAQYGTNLTVDDVNELGQQILNVERKFNEKAGF
TKAHDRLPEFFEKEELPPHDVKFDLSEEELDSLYNFS
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatatttttcgcgtgaatttgtctgagagaagtgtcaaccaagtagaggtccct
gaaagttatcaggccctcggcggtagagctttaacttcacaaattatttacgatgaagtt
aagcccacttctcaccccctaggagaaaacaataaattggtgtttgctccagggttgttg
tcaggtactagagcccccagttcaggtcgtttgtctgtcggtagcatcagtccacttact
aaaggtatcaaggagagtaattccggaggtacagctgcccaggacttggccaaactgggg
ttaaaagcgctagtgatagagggcaaagcagagcaagacaatcaagtcttagttatagat
aaggatggagtccgattagaagaagataatagtttagcaggcctcggcaattacgaggta
ggcgataaattgcgccaaaagtacggagaaaaagtcacaatcatgtccataggaccggct
ggagaatataagatgactgcagccagtatagcagtcaccgatactgatgatcgtccggta
agggcttttggtcgcggcggcctgggtgccgtcatgggtgccaaagggttaaaagccatc
gtcattgacgacgaaggggcccctggcgtagagttgaccgatgaagacgcattcaaagaa
gccagccgcaagttctccaaaatcattctagatcaccctgtttccggtgaggctttgaga
aattacggcacagcagtgttaattaacattctaaacgaggccggcggtctacctactgaa
aacttccgcagcggaagatttgaaactgccaataaaatcagtggcgaaactatgactgaa
accattaaagaaagagacggtaagccaggtcactcctgccatcccggctgtattatggga
tgttccaacgtctatcacgatgacaaaggcgagtatttaaccgcaggttttgagtatgaa
acaatctgggcctttggcgcccactgtaatatcgatgatttggactacatcgcctatttt
gatagatgctgtgacgatttaggtcttgataccatcgaaactggtgtcacttttggcgta
ttcatggaaactgatatgatagaatttggcgataaagaagaagtaaaacgcattttcgac
gaagaaatccgcaaggggacgcccctgggtcagatcctaggttcaggttctgaaacgacc
ggtagagtattcggaatagatcgagtgccgactgtaaagagacaaagtatccccgcttat
gatcccagagctgtcaaaggtgttggtgtaacttacgctaccagtacacaaggtgccgat
cacacagcaggatactctgtcactgccaatatccttaaagtaggtggagaaatcaatcca
ctgaaaaaagaaggccaggtagacctttccagagatctacaggttgccacggcttcaatc
gacagcacagggctttgcctgtttgtcgcatttgctgttctggatagtgatgaagcgctt
cctactgtcgtcgatatgattaacgcccagtacggaacaaacttgacagttgacgatgta
aacgaattaggacagcaaatcttaaatgtagagcgcaaatttaacgaaaaagccggattc
accaaggctcacgacagactgcccgaatttttcgaaaaagaagaattaccaccccacgat
gttaaattcgacctatcggaagaagaattggatagcctgtacaacttctcataa

DBGET integrated database retrieval system