KEGG   Natranaerobius thermophilus: Nther_0909Help
Entry
Nther_0909        CDS       T00761                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00260  Glycine, serine and threonine metabolism
nth00750  Vitamin B6 metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01120  Microbial metabolism in diverse environments
nth01230  Biosynthesis of amino acids
Module
nth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nther_0909
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nther_0909
Enzymes [BR:nth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nther_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP MmgE_PrpD
Motif
Other DBs
NCBI-ProteinID: ACB84494
JGI: Nther0909
UniProt: B2A8C8
Position
963426..964475
Genome map
AA seq 349 aa AA seqDB search
MWKGIVNYYREFLPVDEDFPQCSLQEGNTPLYYAGEISNRVGAEVYLKFEGLNPTGSFKD
RGMVMAVTKAIEDGSDTIMCASTGNTSASAAAYAAKNGLTCAVLVPHGNIAMGKLSQALM
HGAKIIEIEGNFDEALTIVRDITSKHPISLVNSLNPYRLEGQKTAAFEVCDQLQSAPNYL
AIPVGNAGNITAYWKGFQEYRDYNMIENLPRMLGFQAQGAAPILSGEPVQKPETLATAIR
IGNPASWQGALTAVEQSKGEVGSVSDQEIIHAYQTLAKYEGVFVEPASAASVAGIMKLGQ
QGWFKPEDKIVCVNTGHGLKDPDCAINSMEYQPQVIPPLEDQVLDAVYS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggaatagtgaattattatcgtgagtttttacccgtggatgaagattttcct
caatgctctttgcaagaaggaaatacccccctatattatgctggggaaatttccaataga
gttggagctgaagtttatctgaaatttgaaggtttgaatcccacgggatcatttaaagat
agaggcatggtaatggccgttaccaaggccattgaagatggatcagatactataatgtgt
gcttcaacaggtaatacttctgcttcagctgcggcatacgctgcgaaaaatggtttgaca
tgtgcagttctagttccccatggcaatattgccatggggaaattatcccaggcattaatg
catggtgctaaaattatagaaatcgaagggaattttgatgaagctctgactatagtacgt
gatatcaccagtaaacatccaattagcttggtaaactctttgaatccgtatagactagaa
ggacaaaagacagcagcttttgaagtttgtgatcaattacaaagtgctcctaactactta
gctatacctgttgggaatgccggtaatattacagcctactggaaaggatttcaagaatat
agagactacaacatgattgaaaatttaccccgaatgctcggttttcaagctcaaggggct
gcacctatattatcaggagaaccggtacagaaaccggagacccttgctactgctatcaga
attggcaatcccgccagctggcaaggggcgttaactgctgtagaacaatcaaaaggggaa
gtcggctcagtatctgaccaagaaattatccatgcatatcagactttagctaaatacgaa
ggggtttttgtggaaccagcttctgcagcttcagtggcaggcataatgaagttgggtcaa
cagggttggtttaaacctgaagataaaatagtgtgtgtcaatacgggtcatggtttaaaa
gaccctgactgtgccattaattccatggaatatcaacctcaggtgattccgcccttagag
gatcaggttttagacgcggtttattcataa

DBGET integrated database retrieval system