KEGG   Natranaerobius thermophilus: Nther_1125Help
Entry
Nther_1125        CDS       T00761                                 

Definition
uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
nth  Natranaerobius thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1192196..1193746
Genome map
AA seq 516 aa AA seqDB search
MSGRVYLIGAGPGDEGLITVKGLNCVKEANVIVYDRLIPQALLRYAPSTAEFIFVGKSPE
KHTLTQEEINDLLIEQAEQGKIIARLKGGDPFVFGRGGEEVIALKEHNIPFEVVPGITSA
VAAPMYAGIPVTHRGLSSSFAVITGHEDPDKAESSISWQDLALESGTLCFLMGVGNLSRI
VDNLLAHGKDSETPIALVRWGTRPYQKTLTGTLSNIVEKAKSENFKSPAVIIIGEVVNLR
EQLAWFEKKPFFNKNILVTRARSQASELSYKISQLGGQPVEFPTIKIEKPDTYQPLDEAI
KKLAEYNWLVFTSVNGVKHFFNRLENLDYDCRQLAGLKTCAIGSKTKESLEEKGIKADVV
PQEYRAEALIDLMKEQVKSGDRVLIPRAKEAREVLPEALREQGLKVDVITAYETVKDTKD
TEKVRKMLKQNELDAITFTSSSTVKNFVEVLELNVGLNEPGAVLANTHIACIGPITASTC
QQYGIEVNSIANEYTIPGLVESLIDNLDENVEEEFK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagggagagtatatttaataggtgcgggcccaggagatgaaggcctaattactgtc
aaaggcctaaactgtgtcaaagaagctaatgtaattgtttatgaccggcttattccccaa
gctttattgcgatatgcaccttctactgccgagtttatatttgtgggcaaaagccctgaa
aaacatactttaacacaagaagaaataaatgatttattaattgaacaagctgagcaaggt
aaaattattgcaagattaaagggcggtgatccctttgtatttggcaggggaggtgaggag
gtcatagctttaaaagaacataatataccttttgaagtggtacctggtataacttcagca
gtagcagctcctatgtatgcaggaataccagttactcaccgaggactaagttcaagtttt
gcggtcataaccggtcatgaggatccggacaaagctgaaagttctatctcatggcaagac
ttagccttagaaagtggaactttgtgtttcttgatgggagtgggtaacctctccagaata
gttgataacttgctggcccatggaaaagattctgaaacccctatagctttagttagatgg
gggactcgcccctatcagaaaaccctgaccggtaccctatcgaatatagtagaaaaagca
aagagcgaaaactttaaatcaccggcggtaatcataattggtgaagtggtaaatttacga
gaacaactggcttggtttgaaaagaagcccttttttaataaaaatattctagttactagg
gcgagaagtcaggctagtgaactttcatataaaatttcccaactgggtggtcaacctgtg
gagttccccacaattaaaatagaaaaacctgatacataccaacccctggatgaagctatt
aaaaaattggctgaatataactggctggtttttactagtgttaacggggtgaaacacttt
tttaatagattagaaaatttagattatgattgtagacaactcgccggcttaaaaacttgt
gctattggttctaaaactaaagaatctttagaagagaagggtataaaggctgatgtagtg
ccccaagaatatagagctgaagcattgatcgacttaatgaaagagcaagttaaatcaggt
gatcgtgtcctaattccccgtgcaaaagaagctagagaagtactgccggaagctttaagg
gagcagggcttaaaagtggatgtaattactgcttatgaaacagtaaaagacactaaagac
acagaaaaagtccggaaaatgttaaaacaaaatgagttagacgccatcacattcactagt
tcttctacggtaaaaaattttgtggaagtgttagaattaaatgtagggttaaatgaacca
ggcgccgtactagctaacactcatattgcatgtatcggccctatcactgctagtacttgc
caacagtatggtatagaagttaattcaattgccaatgaatatacaattccaggtctggta
gaatccttgatagataatctggatgagaacgtggaggaggagtttaaatga

DBGET integrated database retrieval system