KEGG   Natranaerobius thermophilus: Nther_1299Help
Entry
Nther_1299        CDS       T00761                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nth  Natranaerobius thermophilus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Nther_1299
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nther_1299
Enzymes [BR:nth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Nther_1299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1370743..1372347
Genome map
AA seq 534 aa AA seqDB search
MKSKTLNNLHRLTRLNYESKTEINNRERSEIIKLADLVKPLLKVKVFGKLDGEISGLSYD
SRFTKPGQLFTCIKGTKDDGHKYLEDVLSKGVSAVVAQYDCLSSEQKKLLTQIDIPVILV
TDSRKAFAILASKYYNYPGDSLRVTGVTGTKGKTTTVNLIDKLLSEGKEVKTGMIGTINA
RIDDQEEKQPTTTPGPLELNELLGRIENSGASHVTLEVSSHAISQLRIAGVDLDIAVYTN
LAPEHLDYHTDMDEYKRTKGRIFSFQGLKPEKNDKPKLAVINLDDKYASYMLEQPAVQVL
THGFDENAHVKGKIINTAETFTELKITSPWGNFTVKTPLIGKFNCYNLLAAITVALFEGI
PASKIQTILEQPINIPGRFERIDLGQEFTVVVDFAHTTDSLQEVLQSLRQMVSGKIGVVF
GCGGERDKSKRPKMGRAASDLGDKIFITSDNPRAEDPQKIVQDILSGCDVNNNEKIQIEL
DRAQAIEKSLNWAREGDAVLIAGKGHEATQEINGKVINFDDREIAREKLKKMGY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtaagacattaaataaccttcatagattaacaaggttaaactatgaatcaaaa
acagaaattaataacagggagaggagtgaaattatcaaattagccgatttagtaaaacca
ctactaaaagttaaagtatttggcaaattagacggtgaaatttccggcctgtcatacgac
tcccgatttactaaaccaggccaattgttcacatgtatcaaaggaacaaaagatgatgga
cataagtatttagaagatgtattatctaagggtgttagtgccgtagtggctcaatacgac
tgcttgtcatcagaacagaaaaagttattaacccagatagatattccggtaatactggtg
acagactctagaaaagcttttgccatcttggcgagtaaatactacaactatcctggtgat
agtttgcgagtcactggtgtgacaggaactaaagggaaaaccactactgtaaatctaata
gataagctactttctgaaggcaaagaagtgaaaactggcatgattggaacaatcaatgca
agaatagatgaccaagaggaaaagcagccaactacaaccccaggtcctttagagttaaat
gaactattagggagaattgaaaactcaggggctagtcatgtaaccctagaggttagttct
catgccatatctcaattaagaattgccggtgttgatttagatatagcagtgtataccaat
ttggcacctgaacatttagactaccatactgatatggatgaatataagagaactaaaggg
cgtatattttcttttcaaggccttaagcctgaaaaaaatgataaacctaaactagctgtt
attaacttagatgataaatatgccagctacatgttagaacaacctgccgtacaagttttg
acacacggctttgatgaaaatgcacatgtaaaaggtaaaattataaacacagctgaaacg
tttacggagctaaaaataacatctccttggggaaatttcactgttaaaactcctttaata
ggaaaattcaattgttacaatttgcttgcagcaattaccgtagctttgtttgagggtatt
cctgcttccaaaattcaaacaatcctggaacaacctattaatattccaggaagatttgaa
agaattgacttaggtcaagaatttacagtagtagtagattttgctcatactactgattca
ttgcaggaagtactacaatccttacgtcaaatggtatcgggaaaaattggagttgtattt
ggctgtggaggagaaagggataaaagtaaaagacctaaaatgggtcgtgcggcttctgat
ttgggtgataagatatttatcacttctgataatcctagagcagaagatccccaaaaaatt
gtgcaagatatattatcaggttgtgatgttaacaataatgaaaaaatacaaattgaatta
gatagggcacaggccatagaaaaatctctaaattgggctagagaaggagatgctgtcttg
atagcaggtaaaggacatgaagctactcaggagataaacggaaaagttattaactttgat
gatcgtgagatagcgagagaaaaattgaaaaaaatggggtattag

DBGET integrated database retrieval system