KEGG   Natranaerobius thermophilus: Nther_1329Help
Entry
Nther_1329        CDS       T00761                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00230  Purine metabolism
nth01100  Metabolic pathways
Module
nth_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nther_1329
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Nther_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_17 RsgA_GTPase Thymidylate_kin ABC_tran AAA_16 AAA MMR_HSR1 NTPase_1 AAA_22 ADK AAA_29 RNA_helicase AAA_30 AAA_5
Motif
Other DBs
NCBI-ProteinID: ACB84912
JGI: Nther1329
UniProt: B2A2J7
Position
1402944..1403558
Genome map
AA seq 204 aa AA seqDB search
MKKEGLLVVLSGPSGVGKGTICDHLLDKYSDLEYSISMTTRSPRAGEIHGEDYYFVSKSE
FQEMIADDEFLEWAEVFGNYYGTPRKFVNSKLREGKSVVLEIDIQGALQVKQRCPNGVFI
FLLPPSLDELHKRIRKRGTEQDKDMQTRLTAAKNEIKTVHQYDYAVVNNNIGDTADLIYS
VIKAEKCSVSRVGQKLVKEVIDNE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaggtttactagtagttctttctggtccatcaggagtaggaaaaggtact
atttgtgatcatttacttgataaatactcggatttggaatattctatctctatgactacc
agatctccaagagctggagaaatccatggagaagattattactttgtttcgaaaagtgaa
tttcaagaaatgatcgctgatgatgaatttttagagtgggcagaagtatttggtaattat
tacgggacaccaagaaaatttgtcaactctaaacttagagaaggtaaaagtgttgtctta
gaaattgatattcaaggagcattacaggtaaagcaacgatgtccaaatggtgtatttatt
ttcttattaccaccatccttggatgaattacacaagcgtatccgaaagcggggaactgaa
caagataaggatatgcagacgcgattaacggcagcaaaaaatgaaattaaaactgtacat
caatacgactatgcagttgttaataataatataggtgacactgctgacttgatttattca
gttatcaaagctgaaaaatgcagtgttagcagggttggacaaaaactcgttaaagaggtg
atagataatgaatga

DBGET integrated database retrieval system