KEGG   Natranaerobius thermophilus: Nther_1417Help
Entry
Nther_1417        CDS       T00761                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nth  Natranaerobius thermophilus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nth00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nther_1417
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nther_1417
Enzymes [BR:nth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nther_1417
Two-component system [BR:nth02022]
 CheA family
  CheA-CheYBV
   Nther_1417
Bacterial motility proteins [BR:nth02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nther_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1486715..1487812
Genome map
AA seq 365 aa AA seqDB search
MQKENTNRIKVMVVDDSAFMRKMIVDMVQEEPGLEIVAIAKNGQQALKMIPEHRPHVVTL
DIEMPVLNGIETLEQIKELSDRPNVIMLSSYTQTGSQETLRALELGAVDFVGKPSGSISL
DIKKVQSELIAKIKAAYQATTKVTFDQKKGNPFNSNREISQNIKQKLTNTQKNKLIVIGA
STGGPRALHEVIPKIPQNFPGSILVVQHMPKGFTKLLSERLNTMSSMTVKEAENNDPIVP
GKVYIAPGDYHLMVSKSSGIQGEDKWRVKVDQGPPVKGLRPCADILFESASMIEDMDLVG
VVLTGMGSDGAKGIKRLKRAGAHIIAEDESTCVVFGMPKAAINTGLVDKILPLPAIAPEI
LNVIT
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagagaatactaatcgtataaaagttatggtggtcgatgattcagccttcatg
cgcaagatgatagtagacatggtccaagaagagcccggtttagagattgttgctattgca
aaaaatggccaacaggcacttaaaatgatacctgaacatcgccctcacgttgtcaccctt
gatattgaaatgcctgtattaaatggtatagagacccttgagcaaataaaagagctttct
gaccgtccaaatgttatcatgcttagttcttatacacaaacaggatcccaggaaactcta
agggcccttgaactgggtgctgtagattttgttggcaaaccctcaggttccatttcactt
gatatcaaaaaagtacaatctgagttgatagcaaagattaaagccgcatatcaagctact
actaaggtgacttttgaccaaaaaaagggcaacccgttcaactcaaatcgggagatttca
caaaatataaaacaaaaattaaccaatactcaaaaaaataaactgattgtaataggagct
tccactggagggcctagggcacttcacgaagtgatcccaaaaattccacaaaatttcccg
ggatctattttggtagtacaacatatgcccaaaggatttacaaaactcctgagcgaaagg
ttgaataccatgtcgtcaatgacagtgaaggaagcagaaaataatgatccaatagtcccg
ggtaaagtttatatagctcctggtgattatcatttgatggtttctaaaagttcaggaata
cagggggaagataagtggcgggtcaaagttgaccaaggaccgcccgtaaaaggtcttaga
ccctgtgctgatatattatttgaatcagctagtatgatagaggatatggacttggtaggg
gtagtattaactggaatggggagtgatggtgccaaaggaataaaaaggttaaaacgagcc
ggtgcccatataatagctgaagacgaatcaacttgtgttgtttttggaatgccaaaagca
gctataaataccggcctagtagataaaattttacctttacccgcaattgctccagagata
ctgaatgtgattacctaa

DBGET integrated database retrieval system