KEGG   Natranaerobius thermophilus: Nther_1868Help
Entry
Nther_1868        CDS       T00761                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00250  Alanine, aspartate and glutamate metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nther_1868
Enzymes [BR:nth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Nther_1868
Peptidases [BR:nth01002]
 Cysteine Peptidases
  Family C44
   Nther_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 DUF3700 GATase_6 tRNA_Me_trans NAD_synthase Arginosuc_synth QueC
Motif
Other DBs
NCBI-ProteinID: ACB85440
JGI: Nther1868
UniProt: B2A623
Position
1953932..1955410
Genome map
AA seq 492 aa AA seqDB search
MSGIVAIKGTQAYKDTMVKMLDKLKHRGPQKQNIFPSYASNVLIGECNLEYELSKIDESQ
NPIDNKNHNINLALDGEPLMEGKRLSRNDLIKLFQREGPEFVKFLGDGFALIYTDGKELY
AARDIFGRRPLYYGHDSSNNIYFASEMKALTEICEEIKIFPPGYYYSQDDGFNKYTSIPH
FESNIDEEPGSKDYYEKSARLKYLLIKAVADSWETGKEPGIFLSGGVDSSVVAAALANLT
DKPIHTFAVGIEDSEDIKNAEEVSQYLGTEHTVLTYTEEDMFEVLPEVIYYLESFDVELV
NSSIANYLVSKLAKSNNFEITLSGEGADELFGGYHHLKDCKSDEQLNEALEGLLKGLHNG
GLQRVDRMTNAHSLNCRMPFLHSYIINYALKIPCDWKISGNGMEKLILRQAFDGDLPEQV
LWRKKAQFGIGSGNEKAMEKIIDSEITDQEYYDNKEKHGIDFKSKEEYFYFKIFHKFFPE
KSQTKTVNRWLV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaattgttgctattaaaggtacccaagcttataaagatactatggtcaaaatg
ttagacaaacttaaacaccgaggtcctcaaaaacaaaatatatttccaagctatgcaagc
aatgttttgatcggagaatgtaatctagaatacgaattgagtaaaattgatgaaagccaa
aatcctatagacaacaaaaatcacaatattaatttagcactagatggcgaacccctcatg
gaaggtaagcgcctatcaagaaatgatttaattaaattatttcaaagggaaggtcctgaa
tttgtaaagtttttgggagatggatttgctttgatttatactgatggcaaagaactctat
gctgcaagagacatttttggtagaagaccattatattacggtcatgattcttcaaacaat
atttactttgcatcagaaatgaaagctttgacagaaatatgtgaagaaataaaaattttc
cctccaggttattattattctcaagatgatggttttaacaagtataccagtatacctcat
ttcgaatcaaatattgatgaagaaccaggttctaaggactattatgaaaagtctgctcgg
ttaaagtatttgttaattaaagcagtagccgacagttgggaaacaggcaaagagcctggc
atttttttgagtggaggagttgatagttcagtagtagctgcagctttagccaatttaact
gataaacctattcacaccttcgctgtagggattgaggacagtgaagatataaaaaatgcc
gaagaagttagtcaatatcttggtacagaacatacggttcttacttatacagaagaagat
atgtttgaagtgttaccagaggtgatttactatcttgaatcctttgatgttgagcttgtt
aacagttctattgccaattatttggtctcgaaactcgcaaaatctaataattttgaaatc
acactatcaggtgaaggtgctgatgaactttttgggggatatcatcatttaaaagattgt
aaaagtgatgaacagttaaatgaagctttagaaggattattgaaaggtttacataatggt
ggattgcaaagagttgatcgaatgacaaatgctcattcattaaattgtcgaatgcctttc
ttacactcttatatcataaattacgccctaaagatcccctgtgattggaaaatttcagga
aatggtatggaaaaactaattttacgtcaggcctttgatggagacttacctgagcaggtt
ttatggcgcaaaaaagcccagtttggcattggatcaggaaacgaaaaagctatggaaaaa
atcatagactcggaaatcactgaccaagaatattatgataacaaagaaaaacacggaatt
gattttaaatcaaaagaagaatatttctattttaaaatttttcataaattttttcccgaa
aaatctcaaactaaaactgtcaaccgctggttagtgtaa

DBGET integrated database retrieval system