KEGG   Natranaerobius thermophilus: Nther_1891Help
Entry
Nther_1891        CDS       T00761                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nth  Natranaerobius thermophilus
Pathway
nth03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:nth00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Nther_1891
Enzymes [BR:nth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Nther_1891
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Nther_1891
DNA repair and recombination proteins [BR:nth03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Nther_1891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS FbpA Ribosomal_S13
Motif
Other DBs
NCBI-ProteinID: ACB85462
JGI: Nther1891
UniProt: B2A645
Position
complement(1982099..1982986)
Genome map
AA seq 295 aa AA seqDB search
MPELPEVETIKKSLLSDLTGDRISRVEIYFPGMLQNMSPEDFKESVISNQIKDVKRRGKY
LLIYVSCNGKMKDQVKVIIIHLRMTGRLILKNNEVEKSHNHLDDEEIIQEYRHLRCLFQL
QSGITLEFHDQRKFGTMALVNQGEEFYWKGLANLGPEPLSEEFDYEDFYKGVKKSKKPIK
GILLDQKLVAGIGNIYADEVLFASGIHPARKGEELTEQEVGSLYKTIIQILELGIKYRGT
TFSDYRDSEGNKGNFQDLLKVFNRNKEECLICRREVQKTKVANRGTYYCPNCQPL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaattacctgaggtagaaacaattaaaaagagtctcctttcggatctgaccggt
gatagaataagtcgggtagaaatatattttccaggaatgttacaaaacatgagtcccgag
gattttaaggaaagtgtaatttctaatcagattaaagatgtaaagaggcggggaaaatat
cttctgatttatgtgtcatgtaatggcaaaatgaaggatcaagtaaaagtgataattata
cacttgcgaatgactggtagattgatcttaaaaaacaacgaggtcgagaagtctcacaat
catttagatgatgaggaaatcatccaagaataccggcatcttcgatgtttatttcaatta
caatctggtattactttagaattccatgatcaaagaaagttcggtactatggctctagtt
aatcaaggagaagaattctactggaaaggtttggctaacttaggacctgaacccttaagt
gaagagtttgattacgaggacttttataaaggtgtgaaaaaatcaaaaaagcccattaaa
ggtattctcttagaccaaaaactagtggcaggtataggaaatatttatgcggatgaagtc
ttatttgcatctgggattcatccggctcgaaagggcgaagagttaacagaacaggaagtt
gggagtttgtataaaacaataatacaaatattagaactgggaataaaatatcgtggaaca
acttttagcgactaccgtgattcggaaggtaataagggtaattttcaggacctattaaag
gtttttaataggaacaaagaagaatgcctgatttgccgtagagaagttcaaaaaacaaaa
gttgccaatagaggcacctattattgtccaaactgccaacccctttaa

DBGET integrated database retrieval system