KEGG   Natranaerobius thermophilus: Nther_2005Help
Entry
Nther_2005        CDS       T00761                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00010  Glycolysis / Gluconeogenesis
nth00052  Galactose metabolism
nth00500  Starch and sucrose metabolism
nth00520  Amino sugar and nucleotide sugar metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01120  Microbial metabolism in diverse environments
nth01130  Biosynthesis of antibiotics
nth01200  Carbon metabolism
Module
nth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nther_2005
   00052 Galactose metabolism
    Nther_2005
   00500 Starch and sucrose metabolism
    Nther_2005
   00520 Amino sugar and nucleotide sugar metabolism
    Nther_2005
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nther_2005
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Nther_2005
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nther_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACB85572
JGI: Nther2005
UniProt: B2A6Y1
Position
complement(2113418..2114185)
Genome map
AA seq 255 aa AA seqDB search
MLECQNQDKNNVIGLGIGVPGFVPLKGDRIPQLVNMGLENVPLKFKLEQKFNAHVLVEND
ANAAAWGEHKAGASQGTRDNLLITLGTGVGSGVIVNEAIHRGNLGLTGEIGHILVRPIDG
KLCNCGKVGCLETECSGVAIESKAKALYDEHQLTAREVFNRADNGDETAKRVIQEASYYL
AWGISHALHVLEFEVVVLGGGISRGGNLLLQPVRAYLEDFMGDCPEFPTEKVLVSKLGNK
VALHGLYYLIYEKIN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatgtcaaaaccaagacaaaaacaatgttataggtttagggataggagtgccc
ggatttgttccattaaaaggagataggataccgcaattagttaacatgggtttagaaaat
gttcccttgaaattcaaattagagcaaaaatttaatgcacatgttcttgtagagaatgat
gcaaatgctgctgcatggggagaacataaagccggggcttcacaaggaacccgggacaat
ctattaataactttaggtacaggagtaggtagtggcgtaattgtaaacgaggcaattcat
cgtggaaacttaggtttgactggggagataggacatatattggtgagacctatagatgga
aagctttgtaactgtggaaaagttggctgtttagaaacagaatgttcaggtgttgctatt
gaaagtaaagctaaagctctatatgatgagcatcagttgacagcacgggaagtctttaac
agggccgataatggagacgaaactgcaaaaagagtaattcaagaagcatcgtattactta
gcctgggggatatcccatgctttacatgtattggagtttgaagttgttgtattaggtggt
ggaatttccagaggagggaatttattattacagccagtcagagcttatttagaggatttt
atgggggactgtcctgaatttcccacagaaaaggtgttagtctctaaactcgggaataaa
gttgctctacatggattgtattatttaatatatgaaaagataaactaa

DBGET integrated database retrieval system