KEGG   Natranaerobius thermophilus: Nther_2005Help
Entry
Nther_2005        CDS       T00761                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nth  Natranaerobius thermophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nther_2005
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nther_2005
   00052 Galactose metabolism
    Nther_2005
   00500 Starch and sucrose metabolism
    Nther_2005
   00520 Amino sugar and nucleotide sugar metabolism
    Nther_2005
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nther_2005
   00524 Butirosin and neomycin biosynthesis
    Nther_2005
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nther_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2113418..2114185)
Genome map
AA seq 255 aa AA seqDB search
MLECQNQDKNNVIGLGIGVPGFVPLKGDRIPQLVNMGLENVPLKFKLEQKFNAHVLVEND
ANAAAWGEHKAGASQGTRDNLLITLGTGVGSGVIVNEAIHRGNLGLTGEIGHILVRPIDG
KLCNCGKVGCLETECSGVAIESKAKALYDEHQLTAREVFNRADNGDETAKRVIQEASYYL
AWGISHALHVLEFEVVVLGGGISRGGNLLLQPVRAYLEDFMGDCPEFPTEKVLVSKLGNK
VALHGLYYLIYEKIN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttagaatgtcaaaaccaagacaaaaacaatgttataggtttagggataggagtgccc
ggatttgttccattaaaaggagataggataccgcaattagttaacatgggtttagaaaat
gttcccttgaaattcaaattagagcaaaaatttaatgcacatgttcttgtagagaatgat
gcaaatgctgctgcatggggagaacataaagccggggcttcacaaggaacccgggacaat
ctattaataactttaggtacaggagtaggtagtggcgtaattgtaaacgaggcaattcat
cgtggaaacttaggtttgactggggagataggacatatattggtgagacctatagatgga
aagctttgtaactgtggaaaagttggctgtttagaaacagaatgttcaggtgttgctatt
gaaagtaaagctaaagctctatatgatgagcatcagttgacagcacgggaagtctttaac
agggccgataatggagacgaaactgcaaaaagagtaattcaagaagcatcgtattactta
gcctgggggatatcccatgctttacatgtattggagtttgaagttgttgtattaggtggt
ggaatttccagaggagggaatttattattacagccagtcagagcttatttagaggatttt
atgggggactgtcctgaatttcccacagaaaaggtgttagtctctaaactcgggaataaa
gttgctctacatggattgtattatttaatatatgaaaagataaactaa

DBGET integrated database retrieval system