KEGG   Natranaerobius thermophilus: Nther_2026Help
Entry
Nther_2026        CDS       T00761                                 

Definition
von Willebrand factor type A
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
nth  Natranaerobius thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2137581..2139380)
Genome map
AA seq 599 aa AA seqDB search
MRDLTEVKEKTEYVLTKQQGLILGDATAISTRVHAVSPKKPGAIVAQAQDAGQVFYTRSN
PNEIIHIDCFHQVGKVDHKELSNYLLARLENIIQDYSLPHDFMDFIDIQTGTGGGRLTGS
LEFGKKETLKIAHQNHVHLALYLLPQNYQVLVPLIWYLEEGILEQGMELRKIYNMKIMPL
AKNSQTQEGEDSSLEDYTSSTDSKLKERSDSNREASSLSSDKLNDVQQIAESEGKASQAQ
QTMEELAKGASKQNFLNSASRRKLLTYLKKNRIVKETKDKLYLTPYGQELAELMKRHLPE
IDARLRNMVRTMPKKTNHSIKKIMTRQDSGQRKSPFKERGVKKPDFGDYVEEIALPETIT
AGAKRLYRETYLQNKVEESNKAVLTEQNKQTEQNKQDFKQKSGLTLNPQDIRVRNKKKQT
SMNVCFLVDASGSMGGRRMQEVKFFAEHVLLKGRDKIAILTFREDNVNVEIPFTRNWDKL
RSGLNKIKAFGLTPMSKGIEMARKYLESEVGQQKNTFLVLITDGLPTISDGGEDPFKETL
KAAQKLSQTSIKFVCIGLEPNVKFLKKLAQASQASLYIVEELQKESLARIMDKEKGGHG
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgagagaccttactgaagtcaaagaaaaaactgaatatgttctcacaaagcagcaaggg
cttatcttaggtgatgcaacagccatcagtaccagagtgcatgcagtaagccccaagaaa
ccaggcgcaattgtagctcaagcccaagatgcgggacaagttttttatactcgttctaat
cccaatgaaattattcatattgattgctttcatcaggttgggaaggttgatcataaggaa
ctatccaactatttattggctaggttagaaaatataattcaagattactccttaccccat
gactttatggattttattgatattcaaacagggacaggaggaggaagactaacgggttct
ttagaattcggaaaaaaggaaaccctgaagattgctcatcaaaaccatgttcatttagct
ttatatttattacctcaaaattatcaagttcttgttcctttaatttggtatttagaagag
ggaatcttggaacaaggaatggaattgcgtaaaatttacaatatgaaaattatgccttta
gctaaaaattcccaaacccaggaaggtgaagattcgtcacttgaggattataccagcagc
acagatagtaaattaaaagaacgctccgattctaatagggaagcttcttcactgagttca
gataaattgaatgatgttcaacaaatagcagaatctgaagggaaggcttcccaagctcaa
caaacaatggaagaattagcaaagggagcttcaaagcagaatttcttaaattcagcttct
aggagaaaattacttacttatttaaaaaaaaatcgcatagtaaaagaaacaaaagacaaa
ttatatctgacaccttatgggcaagaactggctgagttaatgaaaaggcacttgccagaa
attgatgctagactgcgtaatatggttagaactatgcctaagaagacaaatcattccatt
aaaaaaataatgactcgacaagatagtggacaacgaaaaagcccttttaaagaaagaggt
gttaaaaagccagatttcggtgattatgttgaagaaatcgctttaccggaaactattaca
gctggtgctaaaagattatatcgggaaacttatcttcaaaataaagtcgaggagagtaat
aaggccgtcctaactgagcaaaataaacagactgagcaaaataaacaggattttaaacaa
aaatcaggtttaaccctaaacccccaggacattagggttaggaataagaaaaaacaaaca
tctatgaatgtatgttttttagttgatgccagtggtagcatgggcgggcgccgcatgcag
gaggttaaattttttgctgaacatgtgttattaaaaggccgagataaaattgcaattctt
acttttcgtgaagacaatgttaatgtggaaataccttttacaagaaattgggataaattg
agatctggattaaacaaaattaaagcctttggtctaacacccatgtccaaaggaattgaa
atggcaaggaaatacctagaatcagaagtcggtcagcaaaaaaataccttcttagtctta
attactgatggattaccaactatttcagatggtggagaagatccttttaaagaaacactg
aaagccgctcaaaaattatctcaaacttccataaaattcgtttgcattggtttagaacct
aatgtaaaatttctaaaaaaattagctcaagcttctcaagcttctctatatattgttgaa
gaactgcaaaaagaatcattagcacgaattatggataaagaaaaaggaggacatggttaa

DBGET integrated database retrieval system