KEGG   Natranaerobius thermophilus: Nther_2066Help
Entry
Nther_2066        CDS       T00761                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00260  Glycine, serine and threonine metabolism
nth00750  Vitamin B6 metabolism
nth01100  Metabolic pathways
nth01110  Biosynthesis of secondary metabolites
nth01120  Microbial metabolism in diverse environments
nth01230  Biosynthesis of amino acids
Module
nth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nther_2066
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nther_2066
Enzymes [BR:nth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nther_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACB85633
JGI: Nther2066
UniProt: B2A742
Position
complement(2183987..2185018)
Genome map
AA seq 343 aa AA seqDB search
MNFLCQNCGKMYEITSLNYTCSCGGLFDFQGTFIGEMKEMVSLGEPVTPIITKSFNNYPL
KLKLDHLMPTGSFKDRGAKVLISALKKLGIEEVVEDSSGNAGAAIAAYCAAAGIDCQIYV
PESASGSKLKQIQAYGAEVVKVPGDRDDTSRAVKKACKNNYYASHIYNPLFFEGTKTIAH
EIYQQIGIPKTMVIPAGNGTLLLGVYKGFYELGNLPKIIAVQSERCAPLTQESDDTTVSA
SSNPTGDTIAKGIAAKNPPRKLEMLKAISDSRGQVLTVSEDEIKSSRQALWNKGIFVETT
AAVAVAGAIKLFDATSSFESTGTLKTDMQDVLVPLTGTGLKEF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctttgtcaaaattgcggtaaaatgtatgaaataactagtttaaattacact
tgttcttgtgggggtttgtttgactttcaagggacttttattggtgaaatgaaagaaatg
gtttctctgggggaaccagtaactcccataataactaagtcttttaataattatcccttg
aaactaaaacttgatcacttaatgcctactggttcatttaaagatcgaggggctaaggta
cttataagtgcattgaaaaagttgggtatagaggaagtagtagaagactcgtcaggtaat
gcgggagctgctattgcggcttactgtgctgctgccgggattgattgccaaatttatgtt
cctgagtctgcttcgggcagcaaattaaagcaaattcaggcctatggtgctgaggtagtt
aaagtacctggggatagagatgatacgtcaagggcagtaaaaaaagcatgtaaaaacaat
tattatgcatcgcatatatataatcctttattttttgaagggactaaaacaatagcccat
gaaatttatcagcaaataggtataccaaaaacaatggtgattcctgcaggaaatggtact
ttattgcttggtgtatataaaggattttatgaattagggaatcttcctaaaattattgct
gtacaaagtgaacgttgtgccccattaactcaagaaagcgatgatacaactgtttcagct
agttcgaatccgacaggtgacactatagccaagggaattgcggctaaaaacccaccaaga
aaactggagatgcttaaggctatttcagatagtagggggcaagtactcactgtatctgaa
gatgagataaaatcctctagacaagctctctggaataagggtatttttgttgaaacaaca
gctgccgttgcagtggctggtgctataaagttatttgatgcaacttcatcttttgaaagt
actggcactttaaaaactgatatgcaagatgtattggtgccattaactggtactggatta
aaagagttttaa

DBGET integrated database retrieval system