KEGG   Natranaerobius thermophilus: Nther_2066Help
Entry
Nther_2066        CDS       T00761                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nth  Natranaerobius thermophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nther_2066
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nther_2066
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nther_2066
Enzymes [BR:nth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nther_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2183987..2185018)
Genome map
AA seq 343 aa AA seqDB search
MNFLCQNCGKMYEITSLNYTCSCGGLFDFQGTFIGEMKEMVSLGEPVTPIITKSFNNYPL
KLKLDHLMPTGSFKDRGAKVLISALKKLGIEEVVEDSSGNAGAAIAAYCAAAGIDCQIYV
PESASGSKLKQIQAYGAEVVKVPGDRDDTSRAVKKACKNNYYASHIYNPLFFEGTKTIAH
EIYQQIGIPKTMVIPAGNGTLLLGVYKGFYELGNLPKIIAVQSERCAPLTQESDDTTVSA
SSNPTGDTIAKGIAAKNPPRKLEMLKAISDSRGQVLTVSEDEIKSSRQALWNKGIFVETT
AAVAVAGAIKLFDATSSFESTGTLKTDMQDVLVPLTGTGLKEF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctttgtcaaaattgcggtaaaatgtatgaaataactagtttaaattacact
tgttcttgtgggggtttgtttgactttcaagggacttttattggtgaaatgaaagaaatg
gtttctctgggggaaccagtaactcccataataactaagtcttttaataattatcccttg
aaactaaaacttgatcacttaatgcctactggttcatttaaagatcgaggggctaaggta
cttataagtgcattgaaaaagttgggtatagaggaagtagtagaagactcgtcaggtaat
gcgggagctgctattgcggcttactgtgctgctgccgggattgattgccaaatttatgtt
cctgagtctgcttcgggcagcaaattaaagcaaattcaggcctatggtgctgaggtagtt
aaagtacctggggatagagatgatacgtcaagggcagtaaaaaaagcatgtaaaaacaat
tattatgcatcgcatatatataatcctttattttttgaagggactaaaacaatagcccat
gaaatttatcagcaaataggtataccaaaaacaatggtgattcctgcaggaaatggtact
ttattgcttggtgtatataaaggattttatgaattagggaatcttcctaaaattattgct
gtacaaagtgaacgttgtgccccattaactcaagaaagcgatgatacaactgtttcagct
agttcgaatccgacaggtgacactatagccaagggaattgcggctaaaaacccaccaaga
aaactggagatgcttaaggctatttcagatagtagggggcaagtactcactgtatctgaa
gatgagataaaatcctctagacaagctctctggaataagggtatttttgttgaaacaaca
gctgccgttgcagtggctggtgctataaagttatttgatgcaacttcatcttttgaaagt
actggcactttaaaaactgatatgcaagatgtattggtgccattaactggtactggatta
aaagagttttaa

DBGET integrated database retrieval system