KEGG   Natranaerobius thermophilus: Nther_2143Help
Entry
Nther_2143        CDS       T00761                                 

Definition
peptidase S8/S53 subtilisin kexin sedolisin
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
nth  Natranaerobius thermophilus
Brite
Enzymes [BR:nth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     Nther_2143
Peptidases [BR:nth01002]
 Serine Peptidases
  Family S8: subtilisin family
   Nther_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2266654..2267766
Genome map
AA seq 370 aa AA seqDB search
MFKVVCILFAFLVIQGGAFAQPESEHDFKEVIIGFEDRPGQAELEIIDEAKGEIDQEFEI
INAVSAKIPEPAVQGMENAEGIDYVEPDYEAQTLQTIPWGIEQINADQAWDEATGTGIDV
AILDTGIDYGHQDLEVVDGVNTVDGGDYMDYNGHGTHVAGTVAALDNNSGVVGVAPDANL
FAGKVLDDDGSGTTSDIVAGIEWAINNDMDIINMSLGMSQYSTALEDVCDEAYYQEDILV
VAAAGNDGEGWWWDPDTINYPANYDSVIAVGATDQNNDRANFSSVGDNLEIMAPGVDVLS
TVPGNDYDEYDGTSMASPHIAGVAALLMDQGVYTSPAEVRDRMNDTADELGDPFYYGNGI
VNTTEALDIH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagttgtctgtattttgtttgcgtttttagtgattcaaggtggtgccttcgct
cagcctgaaagtgagcacgatttcaaagaagttatcattgggtttgaagacagaccaggt
caagctgaattagaaataatcgacgaagcgaaaggtgaaattgatcaggaatttgagata
atcaatgcagtttccgcaaagattcctgaaccagctgttcaaggtatggaaaatgcagaa
ggaattgattatgttgagcccgattacgaagcccaaacattacaaactattccttggggt
atagaacagattaacgctgatcaagcttgggatgaagcaacaggtactggtattgatgta
gctatattagatacaggaattgactacggacaccaagacctggaagttgtagatggtgtt
aacacagttgacggcggtgattacatggactataacggacacggtacccatgttgcagga
actgtagcagcattagataataattctggtgttgtaggtgtagcccctgatgcaaatcta
tttgccggaaaggtccttgacgatgatggtagcggtactactagtgacattgtagcaggt
atcgaatgggcaattaacaatgatatggatataattaacatgagtctgggaatgtctcaa
tatagcactgctttagaagatgtctgtgatgaagcttattatcaagaagatatacttgta
gtagctgccgcaggaaatgatggtgaaggctggtggtgggatcctgacaccatcaattat
cctgctaattacgattctgttattgcagttggagctacagaccaaaacaatgatagagct
aacttttccagtgtaggagacaatctagaaataatggctcctggagttgatgtattaagt
actgtacctggtaatgattatgatgaatatgatggaacatcaatggcatctcctcatatt
gccggagtagcggcattattgatggatcagggagtatatacttctccagcagaagtacga
gatcgcatgaatgacacagctgatgaactgggagatccattttactacggaaacggcatt
gtcaacaccactgaagcattagatattcactaa

DBGET integrated database retrieval system