KEGG   Natranaerobius thermophilus: Nther_2311Help
Entry
Nther_2311        CDS       T00761                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nth  Natranaerobius thermophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Nther_2311
Enzymes [BR:nth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Nther_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2456652..2458832)
Genome map
AA seq 726 aa AA seqDB search
MEMAQIEGIIKRVTYHNPENMFTVAKLVTQETRNEITIVGNMPHLTPGERLDLSGEYVDH
KKFGKQFQVDSYEIKLPVTVDGLIKFLSSGMIKGIGPKTAESLVEHFGKEVLQVIENTPE
KLQEVPGIGKEKAAQISRGFQEHKQIKDIMVFLQEFGVSPAFALKIYRRFGDNTIQKVSE
NPYSLAREVFGIGFKTADKIAREMGVSVDSEERAKAAVVYLLEEKSQDGNTFLKREELIE
ALKELEVENVNLNSVLEELVEEKEIVVENIPEAGELIYPAPFFFAEQGIASRLKRLKDGV
DRELFPRIQKIAEKYLEEQANLVLSPEQHQVIKQVPETGLMVVTGGPGTGKTTVIKCLMD
IFQKAGQKVMLAAPTGRAAKRMSEATGDEAKTIHRLLEFTYDKEEGMKFQRNQDRPLKGD
LLIVDEASMIDTILMNNLLKAISPGTRLVLVGDTDQLPSVGAGNVLQDIIESGRIPLVRL
KRVFRQARESMVVVNAHRINEGKFPILNAKGKDFYFLPREEPEDVVKTIISLCAKRLPNY
NGYHPVNDIQVLSPMRRTVTGVENLNQSLQKVLNPPQKNKAEINFGGACYRTGDKVMQVK
NDYEKNVFNGDTGIVTKVDAEENVVNVRYGHGEEIAYEGRELDALVHAYCISVHKSQGSE
YPVVVLPVTTQHYIMLQRNLLYTAVTRAKSLVVLVGTKKSIGIAISNKKTDERNTFLQHR
IAVYEV
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggctcaaatcgaggggataattaaacgagtaacatatcataatccggaaaat
atgtttacagtagccaaactggtcactcaagagacgagaaatgaaattactatagtaggc
aatatgcctcatttgactccaggagaacgcttggacctttccggagaatatgttgatcat
aaaaaattcgggaaacagttccaggttgatagctatgaaataaaattacctgtaacagta
gatggattaattaaatttctcagttcggggatgattaaagggattggccccaaaacagcg
gaaagtctggtggagcacttcggtaaagaagtgctccaagttattgaaaatacaccggaa
aagttacaggaagtacccggaatcggcaaggaaaaagcagctcagatatccaggggattc
caagagcacaagcagattaaagatattatggtatttttacaggaatttggagtaagtcct
gcttttgctctgaaaatttaccgccgtttcggtgacaatacaattcaaaaggtatctgaa
aatccatattcacttgctagagaggtctttgggattggatttaaaactgctgataaaata
gcccgggaaatgggtgtttcagtagactccgaggagcgagccaaggctgctgtagtctac
ctattagaagagaaatctcaagatggtaatacttttttgaaaagagaagaattaatagaa
gcattaaaggaattggaagtagagaatgtcaatttaaattctgtgctggaagaattagtc
gaagaaaaagaaatagtggttgaaaatatccctgaagcaggtgagctgatttatccggct
cccttcttttttgctgaacagggaattgccagtagattaaaaaggttaaaagatggagtg
gacagggaactatttcctaggatccagaaaatagcagaaaagtatttggaagagcaggca
aatttagttctttctccggaacagcatcaggtgataaagcaggtgcctgaaacaggtttg
atggtggtcacaggtggacctggtacaggtaaaacaacagtgatcaagtgcttgatggat
atatttcaaaaagccggacagaaagttatgctcgctgctcctacgggtagagctgccaag
cgtatgagtgaagccacaggtgatgaagctaaaactattcaccggttgcttgaatttacc
tatgataaggaagagggaatgaaatttcagcgcaatcaagaccgtccactgaaaggtgat
ctattaattgtggacgaggcatccatgatagatacgattttaatgaacaatctgttaaag
gcaatatcacctgggactcgactggtcctggtaggggatactgatcaactaccctcagtt
ggggctggcaatgtccttcaggatatcatcgaatcaggacggatacctttggtcaggtta
aagagagtttttcgccaggccagagaaagtatggttgtggtcaacgctcatagaataaat
gaggggaagtttcccattttgaatgccaagggaaaggacttttattttttacccagagaa
gaacctgaagatgttgttaagacaattatttcactgtgtgccaagcgcttgcctaactac
aacggttatcaccctgtaaacgatattcaggttctgtctcccatgagaaggacagtaacg
ggggtagaaaatttgaatcaatctcttcaaaaagttctcaatcctccgcaaaaaaataag
gctgaaattaactttggtggtgcttgttatcgaacaggggataaagtcatgcaggtcaaa
aacgattatgaaaagaatgtttttaatggagatacaggaattgtaaccaaggtggatgcg
gaagaaaatgtagttaacgttagatatgggcatggtgaagagatagcctatgaaggcagg
gaactagacgctttagtccacgcctattgcattagtgtgcacaagagtcagggaagtgaa
tacccggtggttgttttgccagtgacaacacagcattacatcatgttacagagaaatcta
ctgtacacagctgttactagagctaaatctctagtagttttggtcgggaccaaaaaatca
attgggatagcaatttcaaacaaaaaaaccgatgagcgaaataccttcctacagcacaga
attgcggtctatgaggtttaa

DBGET integrated database retrieval system