KEGG   Natranaerobius thermophilus: Nther_2537Help
Entry
Nther_2537        CDS       T00761                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nth  Natranaerobius thermophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nther_2537
   00052 Galactose metabolism
    Nther_2537
   00500 Starch and sucrose metabolism
    Nther_2537
   00520 Amino sugar and nucleotide sugar metabolism
    Nther_2537
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nther_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2733632..2734510)
Genome map
AA seq 292 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKAQPKEMLPILDKPTIQYIIEEAVESGVEDILIITGRG
KRAIEDHFDRAIELEETLEEKGKQDLLEKVRETNEIDIHYIRQKEPLGLGHAVLCAKKFI
GNEPFGVLLGDDIVRNGGGAPCLKQMIDLYEQEDASVIGVQEVPEQDVSRYGIVENGAEV
SKGAYQVNQLIEKPPVEKAPSRLAIMGRYVISPTIFDYLEKTGPGSGGEIQLTDALNDLA
KVEKVYAYPFKGTRYDAGDLLGYLKTTVEFALEREDVKDEFKEYLKSRFGQI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagaaaagcggtgattccggcagcgggtctcggaactaggtttttacct
gctaccaaagcccaacccaaagagatgcttcctatactagataaaccgacaattcagtat
attatagaagaagctgtggaatctggagtagaagacatattaatcatcactggtaggggt
aagcgtgccatagaagatcacttcgatagagctatagagttggaagaaaccttagaggaa
aaagggaaacaagatctactagaaaaagtaagagagactaatgaaatagatatccattac
ataagacagaaagaacccttaggacttggacatgcagtgctttgtgctaagaagttcatc
ggaaatgaaccttttggtgttttactcggtgatgacatagtcagaaatggtgggggagcc
ccctgcttgaaacagatgatagatttatatgaacaggaagatgctagtgtcataggagta
caggaagtgcctgaacaagatgtaagccgttatggtatagtagaaaacggtgctgaagtt
tctaaaggagcttatcaggtaaatcaattaattgaaaaacctccggtagagaaagcacct
tccaggttagctattatgggaaggtatgttatcagtcctacaatttttgactaccttgaa
aaaactggccctggaagcggaggggaaattcagttgactgatgctttaaatgatcttgcc
aaggtagaaaaggtctacgcctatccttttaaaggaactagatatgatgctggagatttg
ttaggatatttaaagacaacggtagaatttgccttggagcgagaagatgttaaagatgaa
tttaaggaatacttgaagtctaggtttggtcaaatataa

DBGET integrated database retrieval system