KEGG   Natranaerobius thermophilus: Nther_2537Help
Entry
Nther_2537        CDS       T00761                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nth  Natranaerobius thermophilus
Pathway
nth00040  Pentose and glucuronate interconversions
nth00052  Galactose metabolism
nth00500  Starch and sucrose metabolism
nth00520  Amino sugar and nucleotide sugar metabolism
nth01100  Metabolic pathways
nth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nther_2537
   00052 Galactose metabolism
    Nther_2537
   00500 Starch and sucrose metabolism
    Nther_2537
   00520 Amino sugar and nucleotide sugar metabolism
    Nther_2537
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nther_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACB86097
JGI: Nther2537
UniProt: B2A1Q0
Position
complement(2733632..2734510)
Genome map
AA seq 292 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKAQPKEMLPILDKPTIQYIIEEAVESGVEDILIITGRG
KRAIEDHFDRAIELEETLEEKGKQDLLEKVRETNEIDIHYIRQKEPLGLGHAVLCAKKFI
GNEPFGVLLGDDIVRNGGGAPCLKQMIDLYEQEDASVIGVQEVPEQDVSRYGIVENGAEV
SKGAYQVNQLIEKPPVEKAPSRLAIMGRYVISPTIFDYLEKTGPGSGGEIQLTDALNDLA
KVEKVYAYPFKGTRYDAGDLLGYLKTTVEFALEREDVKDEFKEYLKSRFGQI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtaagaaaagcggtgattccggcagcgggtctcggaactaggtttttacct
gctaccaaagcccaacccaaagagatgcttcctatactagataaaccgacaattcagtat
attatagaagaagctgtggaatctggagtagaagacatattaatcatcactggtaggggt
aagcgtgccatagaagatcacttcgatagagctatagagttggaagaaaccttagaggaa
aaagggaaacaagatctactagaaaaagtaagagagactaatgaaatagatatccattac
ataagacagaaagaacccttaggacttggacatgcagtgctttgtgctaagaagttcatc
ggaaatgaaccttttggtgttttactcggtgatgacatagtcagaaatggtgggggagcc
ccctgcttgaaacagatgatagatttatatgaacaggaagatgctagtgtcataggagta
caggaagtgcctgaacaagatgtaagccgttatggtatagtagaaaacggtgctgaagtt
tctaaaggagcttatcaggtaaatcaattaattgaaaaacctccggtagagaaagcacct
tccaggttagctattatgggaaggtatgttatcagtcctacaatttttgactaccttgaa
aaaactggccctggaagcggaggggaaattcagttgactgatgctttaaatgatcttgcc
aaggtagaaaaggtctacgcctatccttttaaaggaactagatatgatgctggagatttg
ttaggatatttaaagacaacggtagaatttgccttggagcgagaagatgttaaagatgaa
tttaaggaatacttgaagtctaggtttggtcaaatataa

DBGET integrated database retrieval system