KEGG   Natranaerobius thermophilus: Nther_2675Help
Entry
Nther_2675        CDS       T00761                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nth  Natranaerobius thermophilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nther_2675
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nther_2675
Exosome [BR:nth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nther_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2882264..2883760)
Genome map
AA seq 498 aa AA seqDB search
MQNYVISLDQGTTSSRAILYDQQGNIVKSAQKEITQHYPQSSWVEHDASEIWGTQSGVLR
EVLETAGIRPNQIAAIGIANQRETTVIWDKESGKPIHNAIVWQDRRTAPICEELEKQGLK
EYIRQNTGLVIDAYFSATKVKWLLDNVNGAREKAKNGQLLFGTVDSWLIWNLTRGHVHVT
DYTNASRTMMFNIHELDWDDKILDVLDIPREMLPEIKESSEIYGYTDEHTLGGAQIPISG
IAGDQQSALFGQGCFERGMMKNTYGTGCFLLMNTGKDPVISKNGLLTTIAWAIDGEIYYA
LEGSIFIAGAAVQWLRDNLKLIDTAHDSEYFAGKSDESNGVYVVPAFQGLGAPYWDMYAR
GAIMGLTRKVGKAEIVRATLESLAYQTRDVVDAMKKDSQLQLQTLRVDGGACQNNLLMQF
QSDIIGTTVERPSDIETTARGAAFLAGLAVGFWDKFDLQKVQQIDNKFTPEMDSQERENR
YAGWQKAVERTMGWARDS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaattatgttatatcactagatcaaggaactaccagttctagagccattctctac
gaccagcagggtaatatagttaaatcggctcaaaaagaaattacccagcactatccacaa
tcgagctgggtagagcatgacgctagcgaaatatgggggacacaaagtggagtactgaga
gaggtcctagagacagccgggataagaccgaatcaaattgcagcaattggtattgccaat
caacgtgaaactacagtcatttgggataaagaatctgggaaaccaattcataatgccatt
gtttggcaggatagaaggacggcacctatttgtgaagaacttgagaaacaggggttgaaa
gaatacataagacagaacactggtttggttattgatgcttatttttcagcgacaaaagtt
aagtggcttctggataatgttaatggggcgcgagagaaagccaagaatgggcaattgctg
tttggtactgtggatagctggttgatttggaatttaacccggggtcatgttcatgtcact
gattatactaatgcttccagaaccatgatgtttaatattcatgaactggattgggatgac
aaaattcttgatgttttagacatacctagagaaatgctgccagaaattaaggaatcaagt
gaaatttatggttataccgatgaacataccctgggtggtgctcaaattccgatatccggg
atagctggtgatcagcaatctgctttatttggacaaggctgttttgaaagaggtatgatg
aaaaatacttacggtactggatgttttttgcttatgaacacaggcaaagaccctgttatt
tcgaaaaatggacttttgactactatagcatgggccatagatggtgaaatctattatgct
ctggaaggcagtatttttattgccggtgcggccgttcagtggttgagagacaatttaaaa
ttgatagatactgctcatgattcggaatactttgcagggaaaagtgacgagagtaatggt
gtttatgtggtaccggcttttcagggtcttggtgctccttactgggatatgtatgctaga
ggcgctattatgggattaactcgcaaagttggtaaagccgaaattgttcgggctaccctg
gaatctctagcatatcaaacccgggatgtggtagatgctatgaaaaaagattcccaactc
caattacagactttacgggttgatggaggagcatgccaaaataaccttttgatgcaattt
caatccgatataattgggactactgtggaacgcccttcagatatagaaaccactgctcgt
ggtgctgcttttttggcaggtttagctgtaggtttctgggataagtttgatctccaaaaa
gttcagcaaatagataacaaatttacacctgaaatggactcccaagaaagagaaaatagg
tatgcgggctggcaaaaagctgttgagaggaccatgggctgggctcgtgatagttaa

DBGET integrated database retrieval system