KEGG   Natranaerobius thermophilus: Nther_2689Help
Entry
Nther_2689        CDS       T00761                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nth  Natranaerobius thermophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nther_2689
Enzymes [BR:nth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Nther_2689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2899411..2900448)
Genome map
AA seq 345 aa AA seqDB search
MSVKFTVMGSLNMDFVLSVPRLPQEGETLLAQNFSTFPGGKGANQAVALARLGGQVNMIG
AVGDDDLGNNLLRNLEQEQIDTTGVQCLADTPTGNAFITVDQQGKNTILVYPGANGELKT
SWVPQHKELIQNSEYLLMQLETPLEVVEATAELADSLGTKVILNPAPGQELSQNLLKRVH
LLTPNETELSVISGMTTETREEQIAAARHLTDLGVDQVVVTLGSEGAFHVDKNMGQQGTH
GHHNTHCNHGTRGTYGTRGTHGTQDSQNPQEATFVDSFSVKAVDTTAAGDSFTAALAIAL
GQGQSIENALKYASAVAAITVTKEGAQSSLPYSHQVDTFLKKGEL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgtaaaatttacagttatgggaagcttaaatatggacttcgtattgtctgtcccc
aggcttccccaggaaggcgaaacactcctagcccaaaatttttctacttttcccggcgga
aaaggcgccaatcaagctgttgccctggcacggttgggaggccaggtgaacatgatcggt
gcagtaggagacgatgatttgggtaataatctactaagaaacttggaacaagaacagatt
gatacaacaggagttcagtgcctagctgacactcctacaggaaatgcctttatcacagtc
gatcaacagggtaaaaacaccattcttgtatatccaggcgccaatggtgaactgaaaaca
tcttgggtgccacagcataaggaattgatccaaaattcagaatatttgctgatgcagttg
gagactcccctagaagtagtagaggccacggctgagttagctgacagtttagggaccaag
gttatcttaaatccagcacctggccaggaactgtcccaaaacctattaaaacgtgtccac
ttgttaactcccaatgaaactgaactatctgtcatatcaggtatgaccacagaaactagg
gaggaacagatagctgccgccaggcatctgactgacttgggtgtggatcaggtagttgtc
actctgggctcagaaggggcctttcatgtggacaagaacatgggtcaacaaggcactcat
ggacatcataacacacactgcaatcacggtactcgcggtacttacggaactcgcggtact
cacggcactcaagactctcaaaaccctcaagaggccacctttgttgacagcttttcggtt
aaagctgtagataccacagcagcaggtgatagctttacagcagccttggcaattgctttg
ggacagggacaaagcatagaaaacgccctcaaatatgcttcagccgtagcggctatcaca
gtgaccaaagaaggagcacaaagctcattaccctattctcatcaggtagataccttcctg
aagaaaggggaactgtaa

DBGET integrated database retrieval system