KEGG   Natranaerobius thermophilus: Nther_2722Help
Entry
Nther_2722        CDS       T00761                                 

Definition
D-fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
nth  Natranaerobius thermophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nther_2722
   01230 Biosynthesis of amino acids
    Nther_2722
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nther_2722
   00030 Pentose phosphate pathway
    Nther_2722
   00051 Fructose and mannose metabolism
    Nther_2722
  Energy metabolism
   00680 Methane metabolism
    Nther_2722
Enzymes [BR:nth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Nther_2722
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Nther_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2937794..2938891)
Genome map
AA seq 365 aa AA seqDB search
MKITLSIIKADIGSIGGHLQPSDKLLNTIEEHLNSYGNDQFIDFYLGYTGDDVFILLTHR
KGINNRQIHQLAWDTFMVGTATAKKQRLYGAGQDLLSDSFSGNIKGLGPAVAEMEIEERE
NEPFLVFTADKTDPGAYNLPLYLSFCDPMHNPGLLLSPKIGDGFTFTVMDVSHTEQDRII
QLNTPEDIYNLAALLRDNERFVVESIHSRKSQEQAAAASTTRLHHIAGKYVGKDDPVLLV
RVQSHFPAVGEILSPYSIGHYVAGFMRGSHHGPLMPVKKNTTVSYFDGPPMVNALAFCVS
EGKLTEPVDCFDQPFWDHIRDKVSRKSLDLREQGFSGPAMLPYSELEYGGITHKMEELEK
RFDFR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacattaagtatcataaaggccgacattggtagtattggtggacacttacaa
ccaagtgataaattattgaatacaattgaagaacacttaaacagttacggtaatgatcag
tttattgatttctatcttggctatactggtgacgatgttttcatacttcttactcatagg
aaaggaataaataatcgacaaattcatcaactggcctgggatacttttatggtaggaact
gccacggctaaaaaacaaagactttatggtgcgggacaagatctactgtccgattccttt
tccggaaacattaaaggtttaggccctgctgtggctgaaatggaaattgaggaacgtgaa
aatgaaccctttttagtattcactgccgataagacagatcctggagcttataatttacct
ttgtatctaagtttttgcgatcccatgcacaaccccggtttactgttatcacctaaaata
ggtgacggttttacttttacagttatggatgtgtctcacacggaacaagatagaataatt
caactaaatactccagaagatatttataatttggctgctctattgagagataatgaaaga
tttgtagtagaatcaattcattcaagaaaatctcaagaacaagctgcagcagcaagtact
actagacttcatcatattgcagggaagtacgtgggaaaagatgatccagtattgcttgtc
agagtgcagagtcatttccctgcagtgggagagattctgtctccttacagcattggacat
tatgtcgccggttttatgaggggaagccatcacggccctctcatgcctgtcaagaaaaat
acaactgtatcttattttgatgggccacccatggtcaatgccctggctttttgtgtcagt
gaaggtaaacttacagaaccagtagattgttttgatcagcctttctgggatcatatccgg
gataaagtctctagaaaatccttggacttacgggaacaaggtttttcaggacctgccatg
ttgccatattctgaattagaatacggtggcatcacccataagatggaagagttagaaaaa
agatttgattttcgttaa

DBGET integrated database retrieval system