KEGG   Natranaerobius thermophilus: Nther_2759Help
Entry
Nther_2759        CDS       T00761                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nth  Natranaerobius thermophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nther_2759
Enzymes [BR:nth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Nther_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2980253..2981254
Genome map
AA seq 333 aa AA seqDB search
MSRRSLWRGLYRKDFSPGEADFTILGIPFDKGCSFREGTCSGPEYIRSSSDRNPPVTEDG
AQLTASVCDMGNIPFQDVFETQRDYFEKVQDQVEEIFKAKYLQNDHMFPIFLGGDHSITI
PLLRAIDQVYKGDEEDIAIIHFDTHLDICDTLDENPLSHGSTHRRGWELDVFKPEHTYFV
GIRCSEAQEHNFLHGKQTNIVTAKQIFMEGPLKMAQQIADLVGNRKTYLTLDIDVLDPAF
APGTGTPVAGGLSSRELLIMLEELSKLNLIGMDLVEVSPPWDNSEITLYSAQKIIFEMMG
YMAPKDKKGDSILNQFSLKQTGSFNYQYYDSQA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaagaagtttgtggcgaggtttatatcgcaaagacttttctccaggtgaagcc
gattttacaattttaggtattccctttgataaaggttgtagttttagggaaggtacgtgc
tccgggcctgagtacatccgctcaagttcagatcggaatcctcctgttacagaagatggg
gcacaattaactgccagtgtttgtgatatgggaaatatcccttttcaagatgtcttcgaa
actcaaagagattattttgaaaaagtacaagaccaagttgaagaaattttcaaggccaag
tatctccaaaatgatcacatgttcccaattttcttgggcggagatcactcaataaccata
cctttgttaagagctatagatcaggtctataaaggtgacgaagaagatatcgccattatt
cactttgacactcatctcgatatatgtgacacattggacgaaaatcccctttcccatggc
agtacccataggaggggctgggagttagatgttttcaagccggaacacacttattttgtc
ggaatcagatgttcagaagcccaagaacataatttcctccatggaaaacagactaatata
gtcacagcaaagcagatctttatggagggccctcttaaaatggctcaacaaatcgctgat
ttagttggaaatcgcaaaacttatttaactttggatatcgatgtcttagatccagctttt
gctccaggaacgggcactcctgtggcaggagggctaagcagccgggaactgttaataatg
ctagaagaattatctaaactaaatttgattggcatggacttggtagaggtatctccacct
tgggataattctgaaatcactctttactcggctcaaaaaattattttcgaaatgatggga
tacatggcaccaaaagataaaaagggtgactccatcttaaatcagttttccttaaaacaa
accggttcttttaactatcaatattacgactcccaggcttaa

DBGET integrated database retrieval system