KEGG   Nicotiana tomentosiformis: 104096351Help
Entry
104096351         CDS       T05025                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00052  Galactose metabolism
nto00500  Starch and sucrose metabolism
nto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nto00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104096351
   00500 Starch and sucrose metabolism
    104096351
Enzymes [BR:nto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104096351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104096351
NCBI-ProteinID: XP_009601011
Position
Unknown
AA seq 581 aa AA seqDB search
MEFLRNSSLWALQILLLYFFAFVSNNGGVDASHKVYMHLQSTSSANVKNVHRTGYHFQPP
KNWINDPNGPMYYNGVYHLFYQYNPKGAVWGNIVWAHSVSTDLINWIPLEPAIYPSKIFD
KFGTWSGSATILPGNKPIILYTGIVDANRTQVQNYAIPANLSDPYLRKWIKPDNNPLIVA
DMSINKTQFRDPTTAWMGRDGHWRILVGSVRNHRGKAILYRSKDFMKWTKAKHPLHTATN
TGNWECPDFFPVSLKHTNGLDTSYNGEYIKHVLKVSLDVTRFEYYTVGTYDTKKDRYIPD
NTSVDGWKGLRLDYGNYYASKSFYDPSKNRRIMLGWANESDTVDDDVRKGWAGVHPIPRK
LWLDPSGKQLVQWPVKELETLRKEKVQLSNHKLYKGEKIEVKGITVAQADVEVTFSFASL
DKAEPFDPSWADLYAQDVCFIKGSTVQGGLGPFGLITLASKNLEEYTPVFFRVFKAQDKY
KVLMCSDASRSTLKNETTMYKPSFAGYVDVDLAYKKLSLRSLIDNSVVESFGAGGKTCIT
SRVYPTLAIFDKAHLFAFNNGTEAITIETLNAWSMADAKLH
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggagtttttaagaaactcttctctttgggctttgcaaattcttttgctgtatttcttt
gcttttgtttcaaacaatggtggtgtcgatgcttctcacaaagtttatatgcacttgcaa
tctactagctctgctaatgttaaaaatgtccacagaactggttaccattttcaaccaccc
aaaaactggattaacgatccaaatggcccaatgtattacaatggagtgtaccatctattc
taccaatacaacccaaaaggagcagtttggggcaacatagtttgggcccattcagtctca
acagatttgattaattggataccacttgagcctgctatttacccttccaaaatatttgac
aagtttggaacatggtcaggttcagctacaattttgccaggcaataagcctattattctc
tacactggaattgtagatgctaacaggacacaagtccaaaactacgcgatcccggctaac
ttgtctgatccatatctccgtaaatggatcaagcccgataacaatccgttaatcgttgct
gacatgagcatcaacaaaactcaatttcgcgacccaacgacagcttggatgggccgagat
ggtcattggagaatcttggttgggagtgtgaggaatcatagaggaaaggcaatattgtac
agaagtaaggacttcatgaaatggaccaaagccaaacatccacttcatacagctaccaat
actggaaattgggaatgccctgattttttcccagtgtcattaaagcatacaaatggtttg
gatacctcatacaatggtgaatacattaagcatgttcttaaggttagtcttgatgttacg
aggtttgagtactacacagtcggtacctatgacaccaaaaaagataggtatattccagat
aacacttctgttgatggttggaagggattaagacttgactatggtaattattatgcgtcc
aaatcattctatgaccctagcaagaatcgaagaattatgttgggttgggctaatgaatca
gatactgttgatgacgatgtcaggaaaggatgggccggagtccaccctatccctcgcaaa
ctatggcttgatccaagtggaaagcaattggttcaatggcctgttaaagaattagaaact
ctaagaaaggaaaaggtccaactaagtaatcacaagttgtacaagggagaaaagattgag
gtcaaaggaatcacagttgcacaggctgatgttgaagtgactttctcgttcgcaagtttg
gacaaggcagagccatttgatcctagttgggctgatctttacgcgcaagatgtatgcttc
attaagggttcaacagtccaaggtggactcgggccatttggactcataactttggcttct
aaaaacttggaagaatacacacctgttttctttagagtttttaaagctcaagataaatac
aaggttcttatgtgctctgatgcctcaaggtcaaccctcaagaatgaaacaactatgtac
aaaccgtcgtttgctggatatgtggatgtagatttagcatataagaagttgtctcttagg
agtttgattgataactcagtagtggaaagttttggtgctggaggaaaaacatgtattaca
tcaagagtttatccaacattagcaatctttgataaggcacatttgtttgccttcaacaat
ggcacagaagcaatcacaattgagactctaaatgcctggagcatggccgatgctaagctg
cactaa

DBGET integrated database retrieval system