KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g101739Help
Entry
NEMVE_v1g101739   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:nve00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:nve04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:nve04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1125 aa AA seqDB search
MAEPKLPWEVYVPLKLQSGTLLSRWDEASFLNKEPNNKLRINTTYVDKCGFFLAWRSQDD
KEGSSIEISNISEVRLGVLPKDQKVRESLQRTGADPLEERGFTVVYNTNLVDCNYLHLFA
STSRVAKEWVEGLRPLLHNVRLDNCSVLTQLHKQYVKAGLHKDALGKISVKSICKALYAG
KFESLVLDALQALGLPCSKNDKITPEDFTFEHFYQLYLKVCPRLEIMELCVEWGGGRAPI
LTATQLVNFMNKEQRDPRLNEILFPFCDNEKALSLIWKYEKQMDMLQRDRICVNGLTRYL
LSEDNLLIMPGRLNLSDDMNQPLSHYFINSSHNTYLVGRQFGGRSSVEMYRQCLIAGCRC
IELDCWDGQNDEPIITHGNAMCTKILFKDVIEAIRDSAFQTSDFPVILSFENHCSKHQQY
KMACYCMDILGDMLVTKPLESCPLEEGRPLPSPNQLRGKILIKNKKLKPEQEAEGESSFY
GTKESSASTQSTESNGDDDEERDSVLPFKGKRDDKGFGSTHRLNMNAYKKVSQCCLDAAS
LTPDDVADIMASFPTQSTTGNINPLLSSLVNYIQPVPFQGFDESEKRNLFYQMSSFNEST
GFGLVRATPLDFVKYNKRQMSRIYPRGSRVDSSNYMPQVFWNVGCQMVSLNFQTPDLPFH
LNQGKFEFNGRSGYILKPDLMRRDDRMFDPFTESPIDGYVGAYVAIKVISGQYLSDKKIT
TVVEVDMYGLPTDTIRKKYKTKSSTSNGLNTLYDGEHMVFRRVVLPEMALLRFAVIDDND
RIIAQRVVPLDSIQAGYRHVPLRTENDTPIPLATLFVHITLRCYVPEGYGAIVDELAEPI
KFQCAADKRAAQMVVFGIDENVRARVIQVEPRLLQHSKEHSRSVGFSLKPTINEQLFIGK
YKIVPIEFIPISLEELKKDKTYRKVIKRQQKESEVIQKKYSKERVMMQRAHTSELEKLIT
SYDEIKQAAQKTYERATKRCGDDRAKALKAVYDKKIAYLSQSQREKAQKVLATQTDEWTS
MISRQIAEEIAIYEQHAETQICVLQAALDQAHEIQLKETVIKHERENSEIKKRQTKQSIE
AGKSIFMDKTIKNKEERERKLKQLDRHNLKQFVEERQKVRDSTSW
NT seq 3378 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgaagcttccttgggaagtgtatgttcctctaaaactccagtctggtacg
ctactgagccgctgggatgaggcaagttttctaaataaagaaccaaataataaacttagg
ataaatacaacttacgtggacaagtgtggattcttccttgcatggcgctcacaggacgac
aaagaagggtctagcatagaaataagcaacattagtgaagtccgtttgggcgttcttccg
aaggatcagaaagtcagagaatctctccagcgtactggcgcagaccccctggaagagaga
gggtttacagtggtttacaacactaatctggtagactgcaactatcttcatttatttgca
agcacaagtagagttgcaaaggaatgggttgaaggtctcagacctctgctgcacaatgtg
cgattggataattgtagtgtcctgacccaactgcacaaacagtatgtgaaggctggcttg
cacaaggatgccttgggaaagatctcagtaaaaagcatctgcaaagctctctatgcgggg
aagtttgaaagtttagtcctggatgctcttcaggcacttgggctcccctgttccaagaat
gacaaaatcactcctgaagacttcacatttgagcatttctaccaactctaccttaaagtc
tgtccccgtctggaaatcatggagttatgtgtagagtggggtggaggacgagcgcccatt
cttactgccacccaactggttaactttatgaacaaagaacagagagatcctcgcctaaat
gaaatcttgtttcctttctgtgataacgagaaggctctttccttaatctggaaatatgag
aaacaaatggacatgttacaaagagatcgcatttgtgtcaatggccttacaagatatctt
ttgagtgaagacaacttgctcatcatgcctggtcgtttaaacttgagtgatgacatgaac
cagcctctatctcattacttcatcaactcttctcacaacacctatctagttggtcgacag
tttggtggaagatcgtctgtagagatgtacaggcaatgcttgatagctggctgtaggtgt
atcgagttggattgctgggatggtcaaaatgacgagcccataataactcatggaaatgcc
atgtgcaccaaaatcctgttcaaggatgtaatagaagcgatacgcgattctgccttccaa
acttcagacttcccagttattctctccttcgaaaaccattgcagtaaacaccagcagtac
aaaatggcatgttactgtatggacatcctaggggatatgctcgtcaccaaaccactggaa
tcatgtcctcttgaagaagggcgaccgctcccttcgccaaaccaattgagagggaaaatt
cttatcaagaacaaaaaacttaagccagagcaggaagctgaaggggaatcgtcgttttat
ggtacgaaggaaagtagtgcgagtactcagagtacggagtcgaatggagacgacgacgaa
gaacgtgattcggttcttccgtttaaaggaaagcgagatgacaagggctttgggagtact
cataggctcaatatgaacgcttacaaaaaggtcagtcaatgctgccttgatgcagctagc
ctaacaccggatgatgtggctgatatcatggcatccttccccactcaatctaccactggt
aacatcaaccctctactctcgtctctagtcaattacatacagccagttccattccaaggc
ttcgacgaatctgaaaagaggaacctcttttatcagatgtcgtcttttaatgagtctact
gggtttggtcttgttagagctactccactggattttgttaagtataacaaacgacaaatg
tcacggatttatcccaggggaagtcgtgtggattctagtaactacatgcctcaggtattt
tggaatgttggctgccagatggtgtcactgaacttccaaacgccagacctaccttttcac
cttaaccaaggaaaatttgaattcaacggaagaagtgggtacatcttgaagcctgacctg
atgagaagagatgatcgcatgtttgacccattcacagagtctcctatcgatggatatgtc
ggtgcatatgttgcaattaaggtgatatccggacagtacttgtcggacaagaaaataacc
acggtagtggaggtggacatgtatggcttgccgacagacactatcaggaagaagtacaag
acgaagtcatccactagcaacggactaaacaccttgtatgacggcgaacacatggttttt
cgaagggtagttctaccagagatggcgttgctccggttcgcagtcatcgatgacaatgat
cgtatcattgcgcagagagtcgtccctctggactccatacaagctggctaccgacacgtc
ccgttacgaacagaaaacgatacaccaatcccactggcgactctatttgtgcacatcact
ttgagatgctacgtccccgagggctatggagcgattgttgacgaacttgctgaacccatc
aagtttcagtgcgctgcagataagcgggcagcacagatggtcgtgtttggcatagatgag
aacgtaagggcacgagttatacaggttgaaccccgcttactacaacactccaaggaacat
tcgagatctgtaggattctccctaaaacccacgatcaatgaacagttgtttattggaaaa
tacaaaatagtgcccatcgaatttatccctataagtttggaggagctaaagaaagacaag
acctacagaaaagttatcaagcggcaacaaaaggagtcggaagtgatccaaaaaaagtac
agcaaggagagggttatgatgcaacgcgcgcacacaagcgagctagaaaagctaataacg
agctacgatgagatcaaacaagctgcacaaaagacgtatgaacgggcgacaaaacgctgc
ggggacgatagagcgaaggccttgaaagcagtttatgacaagaagattgcctatcttagc
cagtcacagcgggagaaggcacaaaaggtcttagctacacagacagacgagtggacaagc
atgatttcacgacagatcgccgaggagattgccatttacgaacaacacgctgagacacaa
atatgtgttctacaagctgccttggaccaagcacatgaaattcagctgaaggaaactgtt
atcaaacatgaaagagagaacagtgagataaagaaaagacaaacaaaacagtcgatagaa
gccggtaaatccattttcatggataagacgatcaagaacaaggaagaacgggaaagaaag
ctcaagcaacttgatcgtcacaacctcaagcagttcgtcgaggagagacaaaaggtcaga
gattctacgagctggtaa

DBGET integrated database retrieval system