KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g104241Help
Entry
NEMVE_v1g104241   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NEMVE_v1g104241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 473 aa AA seqDB search
IEEVNDVKPFKKLLRTNKNLLVLFAKSEKDASKKLSLLGEVAMAIKGKGTVAFINCGDSK
KLCKKFKVSPKPLALKHYKEGDFNKDYDRLDTFKSMMTFMNNPTGDAPWEEEPGSSDVVH
LEKAGELSKLLTREKKPVLIMFYAPWCGYCKRFKPEFAAAATEHKDEAVLAGMDVDTEDG
YSVRVHYNITGFPTTIYFELGQPKYKYSGKHEKDALVQWMKDPSAVAPVKEDEKPWSDTP
SEVVHLRDDMFDDFVAKNPSVLVMFYAPWCGHCKAMKPEYVDAAQTLKEQEIPGVLAAVD
ATKEAALGKRFKVEGYPTGTSYMDGEFAFDVNERKGDSIVNFMKDPKEPPRPPPPEQEWS
EIPSEVYHLSDTTFKSFVKKKKHVLVMFYAPWCGHCKKAKPELMSAAKHHKDKNKIAYAA
VDCTKEMAVCQQFGVEGYPTFRYFNYGKNDFKYTSGREAKDFIQFMDDPREGP
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
attgaagaggtgaacgatgtaaaaccttttaaaaaactcttgaggaccaacaaaaatctt
ctggtgctgtttgctaagagcgaaaaggatgcatctaagaaattgtcacttcttggtgag
gttgccatggcaataaagggaaagggtactgtagcatttattaattgcggtgatagcaaa
aaactctgcaagaaattcaaagtttcacccaagcccttggcactcaagcattacaaggaa
ggggattttaacaaagattatgaccgcctggatacattcaagtccatgatgacatttatg
aataacccaactggtgatgccccatgggaagaagagccagggtccagtgatgtcgtccat
ctagagaaagctggagaactcagcaaactgcttacaagagaaaaaaaacctgttttgatt
atgttctatgcaccatggtgtggatattgcaagagattcaaaccagagtttgcggctgca
gcgacagaacataaagatgaagccgttttagctggaatggatgtcgatacagaagatggc
tatagtgtcagagttcattacaacataactggattccctacaaccatctattttgagctt
ggacaaccaaagtacaagtattctggtaaacatgagaaggacgctcttgtgcagtggatg
aaagatccatctgcagttgctcctgtaaaagaggacgagaagccctggagtgacacaccc
agtgaagtggttcacctcagggatgacatgtttgatgattttgtagcaaaaaatccatct
gtgctggtcatgttctacgccccatggtgtggacactgcaaggccatgaaacctgaatat
gtagatgctgcacagactctaaaggagcaagagatccctggagttcttgctgctgtggat
gccaccaaagaggcagctcttggtaaacgcttcaaggtggaaggttacccaacaggtaca
agctatatggatggtgagtttgcctttgacgtaaacgagaggaaaggagacagtattgtc
aacttcatgaaagatcctaaagaacccccacgacctccgccacctgagcaagaatggagt
gagattccaagtgaggtgtaccacctctcagataccaccttcaagagttttgttaagaag
aagaagcacgttcttgtcatgttctatgcaccttggtgtggtcactgcaagaaggccaag
ccagagcttatgtctgcagccaaacaccacaaggataagaataagattgcatatgctgca
gtggattgcacaaaggagatggctgtgtgccagcagtttggagtagagggctaccccacc
tttagatacttcaattatgggaaaaatgacttcaagtacacttctgggcgagaggccaaa
gattttatccagtttatggatgacccacgtgaaggtccc

DBGET integrated database retrieval system