KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g104658Help
Entry
NEMVE_v1g104658   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g104658
   00240 Pyrimidine metabolism
    NEMVE_v1g104658
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NEMVE_v1g104658
   03410 Base excision repair
    NEMVE_v1g104658
   03420 Nucleotide excision repair
    NEMVE_v1g104658
   03430 Mismatch repair
    NEMVE_v1g104658
   03440 Homologous recombination
    NEMVE_v1g104658
DNA repair and recombination proteins [BR:nve03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      NEMVE_v1g104658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 78 aa AA seqDB search
MLFDTFSFQLADKDVSIDARQDDLKTLREFDLSPEFGPCLGMTRLERWERADRYGLNPPQ
DVKKILALHPTDSNYTDW
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttgatacattttcatttcaactagctgataaagatgtatcaatcgacgcaaga
caagatgacctaaagactttgagggagtttgatctttctccagagtttggaccttgctta
ggaatgacccgacttgagagatgggaaagagctgatagatatgggctgaaccctcctcag
gatgtcaagaaaatcttagccctccaccctactgatagtaactatacagattggtga

DBGET integrated database retrieval system