KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g104769Help
Entry
NEMVE_v1g104769   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03099  
son of sevenless
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    NEMVE_v1g104769
   04068 FoxO signaling pathway
    NEMVE_v1g104769
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    NEMVE_v1g104769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 364 aa AA seqDB search
RVLNGIRHWVDNHFYDFERDAQLLKKLQVFLEEVNGKAMRRWVESINKVIERKTSWDTGS
MAPEITFERDPPQVEWHLAKDIEKFDILTLHPIEIARQLTLLESELYRAVRPSELVGSVW
TKEDIKHLTSPNLLKMIHHTNKITVWFEKSIVEMSNLEERVAVLTRIIDILTVFQELNNF
NGILEVVSALNSAPIFRLQHTFAELTGRRAQVLEEAKELSSDHYKKYIEKLRSINPPCVP
FFGMYLTNILKTEEGNPDFLPNCPEGIINFSKRRKVAEITGEIQQYQNQPYCLRVEDSIR
EYLENLDPFNGRDDKEMEDYLYRSSLEIEPRNCEKLPKFVSTESYLIDIPLTRRNPTDRI
FYPS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
agggttctaaacggcatccgtcactgggtggataaccatttctacgacttcgagcgtgac
gcgcaactactcaaaaagctgcaggtcttccttgaagaagtaaacggcaaagcgatgcgt
cgctgggtggagtctatcaacaaagtcatcgagaggaagacatcttgggatactggtagc
atggcccctgaaataacgttcgagagagacccccctcaagttgaatggcatcttgcgaaa
gacatcgagaagtttgatatcctgacgctccaccccatcgagatcgcacgccaactgacc
ttgctggagtcagagctctacagggccgtgcgtccttcagagcttgtcggcagtgtttgg
acgaaggaggacatcaagcacttgacttccccaaaccttctgaagatgatccaccacacc
aacaagatcaccgtctggtttgagaaaagcattgtggagatgtcaaacttggaagagcgg
gtggcggtgcttacgagaatcatagatatactcactgttttccaagagctgaataatttc
aatggcatcctagaagtagtaagcgcactaaattccgcgccaatctttagattgcagcac
acgtttgcggaattaactggcagaagagcccaggtcttggaagaagcgaaagagttgagc
agtgatcattacaagaagtacatcgagaagctccgctcaatcaatccgccatgtgtacca
ttctttggaatgtacctcacaaatattctcaaaacggaagaagggaaccctgattttctt
cccaactgccccgaaggcatcattaacttcagcaaaaggcgaaaggtagcagaaatcacg
ggtgaaatacaacagtaccagaaccagccgtattgtctcagagtcgaagactccattagg
gaatacctggaaaatctggacccgttcaatggacgcgatgacaaagaaatggaggattat
ttgtaccggagctctttagaaatcgagccgagaaattgtgaaaagctcccaaaatttgta
agtaccgagtcatacttgatagatattcctttgacccggcgaaacccaaccgacagaatt
ttctatccatcataa

DBGET integrated database retrieval system