KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g106064Help
Entry
NEMVE_v1g106064   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:nve04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:nve04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:nve04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:nve04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:nve04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1451 aa AA seqDB search
ADPEKRRLIQQQLVLLLHAHKCQRREQQAANGEMKSCNLPHCRTMKNVLNHMTTCTAGKT
CQVAHCASSRQIISHWKNCMRQDCPVCLPLKHASDRRISQGRAPKLLLLFLLQGHLIAET
TRNNLFMGCKSHQLFSQKKEKKLLSMRRNGKKDTRMGGNRSFGETTSGTSRYFCCATINT
GQMLLVIPPVLFLVSVLMIDLFPSTGSAANRGPKEWHSHVTQDLRTHLVHKLVTAIFPTP
VNDPTAMRDKRMCNLLNYARKVEGDMYETANCKEEYYHLLAEKIYKIQKELEEKRQRRLL
AQMRTTAAPQVGQNQGDNPVKSSYFGFVLAPFHQMNGDPSASQTLRSAQVAAVEAAQQHR
QQPQTQAQSNFSDLLSQLSPQPPCSMAGMPTASAPQLQSSMSSQQQQPQQHQISAQQQLQ
QQQHQQQQLLQQQQQQQSQMPPQSSQSMTGGQNNTQSLTGQGQGKNQMPSPATPQSMSSE
KPSYPQSPKPSTGKGAVPSPSPQRPASSMGKPDTIEKQGITPVSESASSTSQPQKNQKSV
SFCHASMYSDPSQAQSSPSPAQGTAQPVVKTEEDVKPVITMAPASQAVTQSASPHTTSSP
ALPIAGTVRFPFRKGGFLRHLMIKMTMGELPFFCRLDEKTMLLAYSFLHNYLEFKSVSCL
EIALFLPEELRLALMPTLEKLYKQEPESLPFRSPVDPKLLGCLDYFEIVRNPMDLSTIKR
KLDNGQYKNPWEYCDDVWLMFDNAWLYNRKTSRVYKYCTKLSEVFESEIDPVMKLLGYCC
GRKYVFHPQVLCCFGKQLCTITRDTAYYTYQNRQEIVTFPKCFNEIQGDMVNLGEDPTLQ
QSLIPKDQFVKLKNDHLDVEPFVECIDCGRKVHQICVLHHDLIWPTGYQCDACLNKRGVK
KKENKYTARRLQHTRLGEKIETRVNTFLQKQGCPAEVTIRVVSSVQKQAEIKPGMKTRYE
GSGQLPEYFPYQAKALFAFEEIDGTDVCFFGMHVQEYGSDCQQPNTRRVYVSYLDSVHFF
QPRQLRTAVYHEILIGYLEHVGQIGFQMAHIWACPPSEGDDYIFHCHPPEQKIPKHKRLV
DWYKKMLDKAIMDKVVIEYKDILKQASDDGLTNPKELPYFDGDFWPNALEDSIRELDQEE
EERKANAAAAEASGKEGSKVKGNSKRSNSKKGTKSKAGSRKLSKKINGPSMELCDLSQRL
YSTMEKHREVFFVIRLNGRKTPDTSDPDPMMTCDLMDGRDAFLTLARDKHYEFSSNRRAQ
FSTMAMLVELHNQGNDRFVYTCNLCKRPVETRYHCNECEDYDLCVPCYDEKGHEHKMERL
GFDLDVEQQSQPSKDGQPQKMNAQEERRLKIQRCIQSLVHATHCRDINCTMLSCAKMKRV
VEHTKSCRKKTSGGCRICQELIHLCCYHAKHCMERECVVPFCRHIKAKLRQQQLQQRFNQ
QQTLRRRMALM
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
gcagaccctgaaaagcgacgtctaattcaacagcagctggtgctactcctgcatgcacac
aagtgtcaacggcgcgaacagcaagcagccaatggagagatgaagtcatgtaatttgcca
cattgcagaaccatgaagaatgtgctcaaccacatgacaacctgtacagcgggcaagaca
tgccaagtcgcccactgtgcctcttcacgtcagataatatctcattggaaaaactgtatg
agacaagattgccctgtttgtctccctttgaagcatgcatcagataggaggataagccaa
ggtagggctcccaaattattattgttatttttattgcaagggcatttgatcgctgaaacc
accagaaataatttgtttatggggtgcaaatctcatcagttattttctcaaaagaaagaa
aagaaacttttatctatgagaagaaatggtaaaaaagataccagaatgggtggcaacagg
tcatttggagaaacaacatctgggacatcgaggtatttttgctgtgcaaccatcaacaca
ggccaaatgcttcttgttattcccccagtgctttttcttgtgtctgttctcatgattgat
ttgtttcctagcaccggcagtgctgctaaccgtggacctaaggagtggcacagccatgtc
acgcaggaccttagaacacatcttgtgcacaagcttgtgacagcaatatttcccactcct
gtcaatgatcccactgctatgagagacaagcggatgtgcaatctattaaattatgcacgg
aaggtagaaggtgacatgtatgagacagccaactgtaaggaggaatattatcacttgttg
gctgaaaagatctacaagatccaaaaagaattagaagaaaagcgccaaagaagattgctt
gctcaaatgagaacaactgcggcacctcaagttggacaaaatcaaggtgacaaccctgtt
aagtcatcttattttggttttgttttagctccatttcatcaaatgaatggtgatccatct
gcttcacaaacgctaaggtcggcacaagtggcagcggttgaggctgcacagcaacatcga
cagcagccccagacacaagcacagtccaactttagtgatctcctctcccagttatcgccc
cagccaccatgctccatggctggcatgccgacagcctcagcgcctcaactgcagagcagc
atgtcaagtcagcaacaacaaccacaacagcatcagatttctgctcaacaacagcttcag
cagcagcaacaccaacagcagcagttactccagcagcagcagcaacagcagtctcaaatg
ccacctcaatcatctcagtcgatgactggcggccaaaataacacccagtcacttacaggc
caagggcaaggcaagaatcaaatgccttcaccagcaacaccccagtcgatgtccagtgaa
aagcccagctatcctcagtcacccaaaccaagcacaggcaaaggtgcagtgccgtcaccg
agtccacaaagaccagcatcaagtatgggcaagcccgataccattgagaaacaaggcata
actccagtgtctgagtctgcttcaagcacctcacagcctcaaaagaaccagaaatctgta
agtttttgccatgccagcatgtattctgatccaagtcaagcacaaagttcaccttcccct
gcccagggtactgctcagccagtggtaaagacagaggaggatgtgaagcctgtgatcacc
atggcacctgctagccaagctgtcactcaatctgcttcaccccataccacctctagccct
gcccttcctatcgcaggaacagtcaggtttccattcagaaaaggtgggtttttgagacat
ctaatgataaagatgaccatgggagagttgcccttcttttgcagactggacgagaagaca
atgttgttagcatattcattcttgcacaactacttagaattcaaatccgtttcttgtctg
gaaatagcactgtttctcccagaggagctgcgtctggctttgatgccaactttagagaaa
ctgtacaagcaggaaccagagtctctgccattcaggtccccagtagaccccaagcttctt
ggctgcttggattactttgagattgtgagaaacccaatggatctctccacaatcaagcgg
aaacttgacaatgggcagtacaagaatccttgggagtactgcgatgatgtatggttgatg
ttcgataatgcatggttgtataatcgaaaaacctccagagtttataaatattgtacaaag
ttgtcagaagtatttgagtcggaaatagacccagtgatgaaattattgggatattgctgt
ggtagaaaatacgtatttcacccacaagttctgtgctgctttggcaaacagttgtgcaca
ataacgcgggatactgcatactacacataccagaacaggcaagaaatagtcacttttcca
aaatgtttcaatgaaattcaaggtgacatggtcaatcttggtgaagatcccactttgcag
cagagccttatccctaaagaccagtttgtaaagcttaaaaatgaccacttggatgtggag
ccctttgtagagtgtatcgactgtggccgcaaggtccatcagatatgtgtactgcaccat
gacctaatatggccaaccgggtaccagtgtgatgcttgtctaaacaaaagaggagtcaag
aagaaagaaaataaatacactgcaagacggttgcagcataccagactgggcgaaaagatt
gagacccgtgtgaacaccttcctacagaagcagggatgcccagccgaagtcacaatacga
gtggtttcaagtgtgcaaaagcaagcagagatcaaacctggaatgaagactaggtatgag
ggctcaggccaattgccagagtacttcccctaccaggccaaagctctgtttgcatttgaa
gagattgatggcacagacgtttgcttctttggcatgcatgtccaggagtatggctctgat
tgccagcaaccaaacacacggcgtgtatatgtgtcatacctggatagtgtacactttttc
cagccaagacaactccggacagcagtgtaccatgaaatcctaattggctaccttgagcat
gttggccaaatagggttccaaatggcgcacatctgggcttgcccgccaagtgaaggagat
gactacatcttccattgtcacccacctgagcaaaaaatccccaagcacaagcggctcgtt
gactggtataagaagatgctggacaaggccataatggataaagtcgtcattgagtacaag
gatatcctgaaacaggccagcgatgatggcttgacgaatcctaaggagctgccatacttc
gatggggatttctggcccaatgccttggaagacagcatccgagagttggatcaagaagag
gaagagcgcaaagccaatgctgcagcggcggaggcctctggaaaggagggaagcaaggtt
aaagggaacagcaagcggagcaatagcaagaaaggcactaaaagtaaagcaggtagccgt
aagttgagcaagaagatcaacggaccctctatggaattgtgtgacctctctcaaaggctg
tatagcaccatggagaagcacagagaggtgttctttgttattcgtctcaatggtcgcaag
accccagacacgtccgaccctgatcctatgatgacctgtgatctgatggacggcagagat
gcatttcttaccctggcgcgggataaacattatgagttctcatcaaatcgcagagcccag
ttttctaccatggcaatgcttgttgagctgcacaaccaaggaaacgaccgatttgtctac
acctgtaatctgtgcaagagacctgtggaaactagataccactgcaacgaatgcgaggac
tatgacctgtgcgtaccttgctatgacgagaaaggtcatgagcacaagatggagcgactg
ggctttgaccttgacgtagagcagcagtcccagccttccaaggacggccaaccacagaag
atgaatgctcaagaagaaaggagactcaagatccagcgctgcatccagagtcttgtgcac
gcaacgcactgtcgcgacatcaactgtactatgctgagctgtgcaaagatgaagcgggtt
gtagaacacacaaagtcgtgtcggaagaagaccagtggtggctgtcgcatctgtcaggaa
ctcatccacctgtgttgctatcatgccaagcactgtatggaacgagaatgtgttgtacct
ttctgtcggcacatcaaggctaagttacgtcaacagcagttgcagcagagatttaaccaa
cagcagacactgcgtcggcgtatggctctcatg

DBGET integrated database retrieval system