KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g106064Help
Entry
NEMVE_v1g106064   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:nve00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    NEMVE_v1g106064
   04330 Notch signaling pathway
    NEMVE_v1g106064
   04350 TGF-beta signaling pathway
    NEMVE_v1g106064
   04630 Jak-STAT signaling pathway
    NEMVE_v1g106064
   04068 FoxO signaling pathway
    NEMVE_v1g106064
Enzymes [BR:nve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     NEMVE_v1g106064
Transcription factors [BR:nve03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    NEMVE_v1g106064
Mitochondrial biogenesis [BR:nve03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    NEMVE_v1g106064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1451 aa AA seqDB search
ADPEKRRLIQQQLVLLLHAHKCQRREQQAANGEMKSCNLPHCRTMKNVLNHMTTCTAGKT
CQVAHCASSRQIISHWKNCMRQDCPVCLPLKHASDRRISQGRAPKLLLLFLLQGHLIAET
TRNNLFMGCKSHQLFSQKKEKKLLSMRRNGKKDTRMGGNRSFGETTSGTSRYFCCATINT
GQMLLVIPPVLFLVSVLMIDLFPSTGSAANRGPKEWHSHVTQDLRTHLVHKLVTAIFPTP
VNDPTAMRDKRMCNLLNYARKVEGDMYETANCKEEYYHLLAEKIYKIQKELEEKRQRRLL
AQMRTTAAPQVGQNQGDNPVKSSYFGFVLAPFHQMNGDPSASQTLRSAQVAAVEAAQQHR
QQPQTQAQSNFSDLLSQLSPQPPCSMAGMPTASAPQLQSSMSSQQQQPQQHQISAQQQLQ
QQQHQQQQLLQQQQQQQSQMPPQSSQSMTGGQNNTQSLTGQGQGKNQMPSPATPQSMSSE
KPSYPQSPKPSTGKGAVPSPSPQRPASSMGKPDTIEKQGITPVSESASSTSQPQKNQKSV
SFCHASMYSDPSQAQSSPSPAQGTAQPVVKTEEDVKPVITMAPASQAVTQSASPHTTSSP
ALPIAGTVRFPFRKGGFLRHLMIKMTMGELPFFCRLDEKTMLLAYSFLHNYLEFKSVSCL
EIALFLPEELRLALMPTLEKLYKQEPESLPFRSPVDPKLLGCLDYFEIVRNPMDLSTIKR
KLDNGQYKNPWEYCDDVWLMFDNAWLYNRKTSRVYKYCTKLSEVFESEIDPVMKLLGYCC
GRKYVFHPQVLCCFGKQLCTITRDTAYYTYQNRQEIVTFPKCFNEIQGDMVNLGEDPTLQ
QSLIPKDQFVKLKNDHLDVEPFVECIDCGRKVHQICVLHHDLIWPTGYQCDACLNKRGVK
KKENKYTARRLQHTRLGEKIETRVNTFLQKQGCPAEVTIRVVSSVQKQAEIKPGMKTRYE
GSGQLPEYFPYQAKALFAFEEIDGTDVCFFGMHVQEYGSDCQQPNTRRVYVSYLDSVHFF
QPRQLRTAVYHEILIGYLEHVGQIGFQMAHIWACPPSEGDDYIFHCHPPEQKIPKHKRLV
DWYKKMLDKAIMDKVVIEYKDILKQASDDGLTNPKELPYFDGDFWPNALEDSIRELDQEE
EERKANAAAAEASGKEGSKVKGNSKRSNSKKGTKSKAGSRKLSKKINGPSMELCDLSQRL
YSTMEKHREVFFVIRLNGRKTPDTSDPDPMMTCDLMDGRDAFLTLARDKHYEFSSNRRAQ
FSTMAMLVELHNQGNDRFVYTCNLCKRPVETRYHCNECEDYDLCVPCYDEKGHEHKMERL
GFDLDVEQQSQPSKDGQPQKMNAQEERRLKIQRCIQSLVHATHCRDINCTMLSCAKMKRV
VEHTKSCRKKTSGGCRICQELIHLCCYHAKHCMERECVVPFCRHIKAKLRQQQLQQRFNQ
QQTLRRRMALM
NT seq 4353 nt NT seq  +upstreamnt  +downstreamnt
gcagaccctgaaaagcgacgtctaattcaacagcagctggtgctactcctgcatgcacac
aagtgtcaacggcgcgaacagcaagcagccaatggagagatgaagtcatgtaatttgcca
cattgcagaaccatgaagaatgtgctcaaccacatgacaacctgtacagcgggcaagaca
tgccaagtcgcccactgtgcctcttcacgtcagataatatctcattggaaaaactgtatg
agacaagattgccctgtttgtctccctttgaagcatgcatcagataggaggataagccaa
ggtagggctcccaaattattattgttatttttattgcaagggcatttgatcgctgaaacc
accagaaataatttgtttatggggtgcaaatctcatcagttattttctcaaaagaaagaa
aagaaacttttatctatgagaagaaatggtaaaaaagataccagaatgggtggcaacagg
tcatttggagaaacaacatctgggacatcgaggtatttttgctgtgcaaccatcaacaca
ggccaaatgcttcttgttattcccccagtgctttttcttgtgtctgttctcatgattgat
ttgtttcctagcaccggcagtgctgctaaccgtggacctaaggagtggcacagccatgtc
acgcaggaccttagaacacatcttgtgcacaagcttgtgacagcaatatttcccactcct
gtcaatgatcccactgctatgagagacaagcggatgtgcaatctattaaattatgcacgg
aaggtagaaggtgacatgtatgagacagccaactgtaaggaggaatattatcacttgttg
gctgaaaagatctacaagatccaaaaagaattagaagaaaagcgccaaagaagattgctt
gctcaaatgagaacaactgcggcacctcaagttggacaaaatcaaggtgacaaccctgtt
aagtcatcttattttggttttgttttagctccatttcatcaaatgaatggtgatccatct
gcttcacaaacgctaaggtcggcacaagtggcagcggttgaggctgcacagcaacatcga
cagcagccccagacacaagcacagtccaactttagtgatctcctctcccagttatcgccc
cagccaccatgctccatggctggcatgccgacagcctcagcgcctcaactgcagagcagc
atgtcaagtcagcaacaacaaccacaacagcatcagatttctgctcaacaacagcttcag
cagcagcaacaccaacagcagcagttactccagcagcagcagcaacagcagtctcaaatg
ccacctcaatcatctcagtcgatgactggcggccaaaataacacccagtcacttacaggc
caagggcaaggcaagaatcaaatgccttcaccagcaacaccccagtcgatgtccagtgaa
aagcccagctatcctcagtcacccaaaccaagcacaggcaaaggtgcagtgccgtcaccg
agtccacaaagaccagcatcaagtatgggcaagcccgataccattgagaaacaaggcata
actccagtgtctgagtctgcttcaagcacctcacagcctcaaaagaaccagaaatctgta
agtttttgccatgccagcatgtattctgatccaagtcaagcacaaagttcaccttcccct
gcccagggtactgctcagccagtggtaaagacagaggaggatgtgaagcctgtgatcacc
atggcacctgctagccaagctgtcactcaatctgcttcaccccataccacctctagccct
gcccttcctatcgcaggaacagtcaggtttccattcagaaaaggtgggtttttgagacat
ctaatgataaagatgaccatgggagagttgcccttcttttgcagactggacgagaagaca
atgttgttagcatattcattcttgcacaactacttagaattcaaatccgtttcttgtctg
gaaatagcactgtttctcccagaggagctgcgtctggctttgatgccaactttagagaaa
ctgtacaagcaggaaccagagtctctgccattcaggtccccagtagaccccaagcttctt
ggctgcttggattactttgagattgtgagaaacccaatggatctctccacaatcaagcgg
aaacttgacaatgggcagtacaagaatccttgggagtactgcgatgatgtatggttgatg
ttcgataatgcatggttgtataatcgaaaaacctccagagtttataaatattgtacaaag
ttgtcagaagtatttgagtcggaaatagacccagtgatgaaattattgggatattgctgt
ggtagaaaatacgtatttcacccacaagttctgtgctgctttggcaaacagttgtgcaca
ataacgcgggatactgcatactacacataccagaacaggcaagaaatagtcacttttcca
aaatgtttcaatgaaattcaaggtgacatggtcaatcttggtgaagatcccactttgcag
cagagccttatccctaaagaccagtttgtaaagcttaaaaatgaccacttggatgtggag
ccctttgtagagtgtatcgactgtggccgcaaggtccatcagatatgtgtactgcaccat
gacctaatatggccaaccgggtaccagtgtgatgcttgtctaaacaaaagaggagtcaag
aagaaagaaaataaatacactgcaagacggttgcagcataccagactgggcgaaaagatt
gagacccgtgtgaacaccttcctacagaagcagggatgcccagccgaagtcacaatacga
gtggtttcaagtgtgcaaaagcaagcagagatcaaacctggaatgaagactaggtatgag
ggctcaggccaattgccagagtacttcccctaccaggccaaagctctgtttgcatttgaa
gagattgatggcacagacgtttgcttctttggcatgcatgtccaggagtatggctctgat
tgccagcaaccaaacacacggcgtgtatatgtgtcatacctggatagtgtacactttttc
cagccaagacaactccggacagcagtgtaccatgaaatcctaattggctaccttgagcat
gttggccaaatagggttccaaatggcgcacatctgggcttgcccgccaagtgaaggagat
gactacatcttccattgtcacccacctgagcaaaaaatccccaagcacaagcggctcgtt
gactggtataagaagatgctggacaaggccataatggataaagtcgtcattgagtacaag
gatatcctgaaacaggccagcgatgatggcttgacgaatcctaaggagctgccatacttc
gatggggatttctggcccaatgccttggaagacagcatccgagagttggatcaagaagag
gaagagcgcaaagccaatgctgcagcggcggaggcctctggaaaggagggaagcaaggtt
aaagggaacagcaagcggagcaatagcaagaaaggcactaaaagtaaagcaggtagccgt
aagttgagcaagaagatcaacggaccctctatggaattgtgtgacctctctcaaaggctg
tatagcaccatggagaagcacagagaggtgttctttgttattcgtctcaatggtcgcaag
accccagacacgtccgaccctgatcctatgatgacctgtgatctgatggacggcagagat
gcatttcttaccctggcgcgggataaacattatgagttctcatcaaatcgcagagcccag
ttttctaccatggcaatgcttgttgagctgcacaaccaaggaaacgaccgatttgtctac
acctgtaatctgtgcaagagacctgtggaaactagataccactgcaacgaatgcgaggac
tatgacctgtgcgtaccttgctatgacgagaaaggtcatgagcacaagatggagcgactg
ggctttgaccttgacgtagagcagcagtcccagccttccaaggacggccaaccacagaag
atgaatgctcaagaagaaaggagactcaagatccagcgctgcatccagagtcttgtgcac
gcaacgcactgtcgcgacatcaactgtactatgctgagctgtgcaaagatgaagcgggtt
gtagaacacacaaagtcgtgtcggaagaagaccagtggtggctgtcgcatctgtcaggaa
ctcatccacctgtgttgctatcatgccaagcactgtatggaacgagaatgtgttgtacct
ttctgtcggcacatcaaggctaagttacgtcaacagcagttgcagcagagatttaaccaa
cagcagacactgcgtcggcgtatggctctcatg

DBGET integrated database retrieval system