KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g106419Help
Entry
NEMVE_v1g106419   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
nve  Nematostella vectensis (sea anemone)
Module
MAPK (ERK5) signaling
Brite
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     NEMVE_v1g106419
Protein kinases [BR:nve01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   NEMVE_v1g106419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 450 aa AA seqDB search
MNCAPSLVIRIIPEDGKAVDWAVNPTITFRDVLEAISQVMPHATATAFDYEDEEKDRITV
RSDEELQAMINGYFWYYSERMKQGVGLDPLPIYPRAGRTSRKRNICGLTVNTRAPLSPSG
QTSMPAPMNSHLQHQPTTAPSILAGGQLNQEQIQHLEILGYGNGGTVYKAIHLTTRRIIA
VKVIPLDVTPEVQRQIISEMEISFQCASPYIIEFYGAFFVENRISMCTEYMDGGSLDMYG
SIPEPVLGRIAVAVVKGLAYLWGLKIMHRDVKPSNILVNTRGQVKLCDFGVSRQLVNSIA
TTYVGTNAYMAPERILGDEYSILSEVWSLGVSLLEMASGRFPYLKVSIQLASYFFFGNHC
FLVPIELLQCIVHEAPPRLPDHLFSPVFVDFVAQCMQKSPSTRLTPEAVLDHIFIRMSDD
GNIDMISMWVCRRLEEKRAVTTNLDSPSSE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtgcgccttctctagttatacggattattcctgaagatggaaaagccgttgac
tgggccgtgaatccgacgattacattccgagatgtcctggaggctatatctcaggtgatg
cctcacgcaacagccacagcatttgactatgaggatgaggaaaaagatcgcatcacagtt
aggagcgatgaggaattacaagcaatgattaatgggtacttctggtactattcagagagg
atgaagcaaggagttggattagatcccctccctatctaccctagagctggacgaacatcg
aggaaaagaaatatttgtggcctaactgtaaatacaagagctccgctatcaccatcaggc
cagacctccatgccagctcccatgaactcccatctacaacatcaaccaacaactgccccc
agcatattggcaggtggccagttaaaccaggagcagatccaacaccttgagattctgggg
tatgggaatggtggaactgtgtacaaggcaatacacttaacaacaaggagaatcattgca
gtaaaggtcattccgctagatgttacaccagaagtgcagagacaaatcatatcggaaatg
gaaatttctttccagtgtgcttctccttatattattgagttctatggtgcattctttgtt
gaaaatagaatatcaatgtgtacagaatatatggatggtggctctctagatatgtacggc
agcataccggagccggttctcggtagaatcgcagtcgcagttgtcaaggggctggcatac
ctttggggactcaagataatgcatagagatgtaaagccgtccaacatacttgtcaataca
agaggacaagtcaagctttgtgattttggcgtcagtcgccagctcgtgaattctatagct
actacatacgtgggaactaatgcttacatggcgccggagaggattctgggtgatgagtac
agcatactgtccgaggtctggagccttggagtatccctattagagatggcgagtggtaga
ttcccgtatctcaaggtaagcatccaattggcctcctatttcttctttggaaaccactgt
tttctagttccaattgaactgcttcaatgcatagtacacgaggccccgccgcgtctacct
gaccatctgtttagcccggtgtttgtggactttgtggctcagtgtatgcaaaaaagtccg
tccactcgcctcacccctgaagctgtgctggatcacatctttattcggatgagcgatgat
ggaaatattgatatgatatccatgtgggtttgtcgccgtctggaagagaaaagagcggta
acaaccaacttagatagtccttcatcagaatag

DBGET integrated database retrieval system