KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g108592Help
Entry
NEMVE_v1g108592   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NEMVE_v1g108592
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     NEMVE_v1g108592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 344 aa AA seqDB search
LPPSRKMLVFVNPFSGKGKSLKIFRNKVAPMFENADIDYKLVITEYAGHAKAYASQLCIP
EWDGVVICSGDGLVFEVLNGFMNRQDWEVAIKMPIGVIPTGSGNALCFSSLHASGEPMEV
VCAIYAVIRGNIHEMDIASIVTPTSRFYSFLSMTWGIMSDVDIESEKYRYLGNARFTVGA
VVRILNLRLYQGRISYLPYEEDGQFTRSSGNQFGPELNLLPALEENLPSSWKSVEGKFIL
CSSVMMSHLGPDICAAPQSKFGDGILYVAYAEAGISKMQLLDMFMKMEDGSHIDCEEIVC
VRACAFRLEPDLTQLGTIAIDGELIPYSAVQGQVHRGLGRVMCV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ctcccaccaagccgtaaaatgttagtgtttgtcaacccattcagtgggaaaggaaagagt
ctcaagattttcagaaataaagttgctccgatgtttgagaatgctgatattgattacaag
ctagtcattaccgagtacgccggtcatgcaaaggcttatgcatcacagctgtgtattcct
gagtgggatggggtggtcatctgctcaggggatggactggtgtttgaggttcttaatggt
ttcatgaatcgtcaagattgggaggtggccatcaagatgccaataggtgtaatccctaca
ggttctggtaatgctctctgtttctcatcactccatgcttcaggtgagccaatggaagtg
gtatgtgcaatatatgctgtcatccgcggcaacattcatgagatggacattgcatcaatt
gtcacccctactagccgattctactcattcctatctatgacatggggcatcatgtcggat
gtagacattgaatctgagaaatacagatacctgggcaatgcacgctttactgtcggtgct
gtggtcagaatcctgaacttacggctttaccagggaagaatctcctaccttccatatgag
gaggacggccagtttacaaggtcttctgggaatcaatttggacctgagcttaaccttctt
cctgctcttgaggaaaaccttccatcttcctggaaaagtgtggaggggaaattcatttta
tgttcatctgttatgatgtcacaccttggcccagacatttgtgcagccccacaatccaag
ttcggggatggtattttatatgttgcatacgcagaagcaggtatttccaaaatgcagctc
ttggacatgttcatgaaaatggaggatggttcccacatagattgtgaggagattgtttgt
gtcagggcgtgtgcattccgcttggaaccggacttgacacagttgggaactatagctata
gatggtgaactaattccatactctgccgtgcagggacaggtccatcgaggcttaggcaga
gttatgtgcgtttag

DBGET integrated database retrieval system