KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g111922Help
Entry
NEMVE_v1g111922   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NEMVE_v1g111922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 431 aa AA seqDB search
MTKKRVVYFYDEDVGNFHYGPGHPMKPHRLTLTHNLVFNYGLHKKMEVYKPYRATNHDMS
RFHSSDYIDFLSRVTIQNNPNLSKSMSDFNVGEDCPVFPGLFDFCSIYTGASLEGAVRLN
QGICDIAINWAGGLHHAKKCEASGFCYVNDIVVAILELLKYHNRVLYVDIDIHHGDGVQE
AFYLTDRVMTVSFHKYGNHFFPGTGDMYEVGVDNGRLYSVNVPLRDGIDDQNYASLFKPV
INMVIDHYQPTCIVLQCGADSLGCDRLGCFNLSTKGHGECVRFMKTFNLPMLVLGGGGYT
IRNVARCWAYETSLLVDQQVSTEIPYNDYLEYFGPDFSLHPDIASRIENQNTKQYLDQIR
QTVSENLKNLNGAPSVQMQHVPPDLLCLEANEDQMDADGRQTDDETKYVLADNEYFDGEQ
DVDRDEAYLDV
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagaaaagagtcgtatacttttacgatgaggacgtcggtaattttcactatgga
cctggccatcctatgaagccccacagattgacactcacacacaacttggtgttcaactat
ggcttgcacaagaagatggaggtgtacaagccatacagagccacaaaccatgacatgagt
cggtttcattcaagtgactacattgactttctatcaagggtgacaatacaaaataaccct
aacctatcaaagagcatgagtgacttcaatgttggagaggactgccctgtgtttccagga
ttgtttgatttctgctcgatatacacgggtgcatcgctggagggggctgttcggctgaac
caggggatttgtgacattgccatcaactgggccggtgggttacatcatgccaaaaagtgt
gaggcatcagggttttgctatgtgaatgacatagttgttgcaatccttgagcttctcaag
tatcataaccgagtgctgtacgttgatatcgacattcaccatggcgatggtgtacaggaa
gcattttacctgactgatcgtgtcatgactgtctcatttcataagtatggcaaccacttc
tttcctggtacaggtgacatgtatgaggttggtgttgacaatggaagactgtattctgtc
aatgttcccttgagagatggaattgatgatcaaaattatgccagtttattcaaacctgtt
ataaacatggtgattgatcattatcaaccaacatgcatagtgctacagtgtggtgcagat
tctctaggctgtgatagattgggttgcttcaatctcagtacaaaaggacatggggagtgt
gttcgattcatgaagaccttcaatctccccatgctggtgttaggtgggggtggttacacc
atcaggaatgtagcaagatgctgggcatatgagacatcactcttggttgaccagcaagtt
tccacagagatcccatataatgattacctggaatattttggtccagatttctctcttcat
ccagacattgcatcaagaatagaaaatcagaataccaaacaatacctggaccagattcgc
cagactgtgtctgaaaacctcaagaacctgaatggtgcaccaagtgtccagatgcagcat
gtcccccctgacctgctttgcctggaagccaacgaggaccagatggatgcagatggcaga
cagactgacgacgagaccaagtacgtgctggccgataacgagtacttcgatggtgagcag
gatgttgacagagacgaggcttatctcgacgtgtga

DBGET integrated database retrieval system