KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g112390Help
Entry
NEMVE_v1g112390   CDS       T01037                                 

Definition
hypothetical protein
Orthology
K03173  
TNF receptor-associated factor 2
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NEMVE_v1g112390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 482 aa AA seqDB search
STDIAMVGYEIATTDTAIAAKHLCAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQCD
VCGSTITKPETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVH
PECGKKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHHEKTCPSYPVNCPKCSKE
LIRVEVHSTPFTREPRLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISEN
IDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLER
QLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSP
CFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN
VEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIVDKPD
WA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
tcaacagatattgctatggtaggatacgaaatcgccacgacagatactgcaattgccgcg
aagcacctgtgtgcaaagtgccgccttattgtcaaagacgctgtacagactgcctgtggg
caccggtactgctctccgtgcataagtcccctattaagccgaggtccaatacaatgtgac
gtttgtggctcaacaataaccaagccggagaccttccgtgacaaattcgccgatcgtgag
atactggaactccatgtgcactgtgtgaaccagcctcacggctgcccctgggagggagaa
ctgcgacacagacagaatcaccacaccaagtgcgagtttaatccaatatcctgtgtgcat
ccagagtgtggcaagaaactgtctgtggctaagctaccagagcatctacagaacgaatgt
cagtacagagaagagacttgctcgtattgtgaacaacccgtggtggtagcccgcatgaag
gaacaccacgagaagacgtgtccttcatatcccgtcaactgcccgaagtgcagcaaagag
ctaattcgagttgaggtacattccactccatttacccgggagcctcggttagaaaagggg
aggggatgcgagaatacacttgaagtgctagaagaccacgaaagcaggataaaaaagctg
gagcaaagaggtggtggaatcggcgtcaacgggctgcagtctatgcggatttcagaaaac
attgataacgaagctataggagatgtgctgcggcgtgtggccaatgtggaagccaagggt
gcggatcatgaagtactggtcgtcgaagcgcactcagccgtagatgaactacgcagggag
gtgggacgtctaaatgtcaagctacaggaatccgatgacatcattcgtaggcttgagcgg
cagctagagttacacgaccagggaacaggactacgcaatcttgcaatcgctgatctggaa
gaacggctaaacaccctacaaggcacaacgttcgatagtgttctcttgtggaagatcact
aacgtcgcgaacaaacgcagcgaggcaacgtcaggacgtgtgacctcattctacagccct
tgctttttcaccggtccccatgggtacaagatgtgcgcgcgcatctacctgaatggggac
ggcatggggcgtaaccatcacgtgtctttgttctttgttatcatgcgcggtgagttcgat
gccctgctgcgctggcccttcagacaaaaggtaacgttgatgctcctggaccaagataat
gtggagcacgtgatcgacgcgttccgcccagacccttccagcagctcgttccagcgtcct
cgcgccgagatgaacatcgcgagtggctgtccgctcttctgctcccacgaacagcttacg
caacacgcgtacattcgtgacgacacgatgttccttaagatcatcgtggacaagccagac
tgggcatga

DBGET integrated database retrieval system