KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g11424Help
Entry
NEMVE_v1g11424    CDS       T01037                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Enzymes [BR:nve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NEMVE_v1g11424
Protein phosphatases and associated proteins [BR:nve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NEMVE_v1g11424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 369 aa AA seqDB search
TGLVYDDRMKRHVNIWDKYVYINTLICSLYEVPDRIGRPYEKHKEYGLLDRCYKIPSRHA
TEEDLLCLHSKEHIDKMKSTQDMKPRDLFNLGEEYDSIYMSKDVYDCALLSCGCTLAAVE
HVATNKSSKHSIHINQLFFLRPPGHHADADSAMGYCFFNNVAIAAKLAQQRWGMQRILIV
DWDIHHGNGTQNLFESDPSVLYFSLHRYDHANFYPFSAQANYDIVGKGQGKGFNVNVPWN
KSHIGDADYIAAFQQILLPIAYEFDPDIVLVSAGFDSARGDPKGYCDITPEGYCHLTNML
MSLAGGKVVVILEGGYNITSVAESMCSCTSTLLGDPCPRLDGPMVPCQSVLKSISNVVNV
HKQFWKNLT
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
actggattggtatatgatgatcgtatgaagagacatgttaacatctgggataagtatgtt
tatattaataccttaatttgttcattatatgaagttcccgatagaataggtcgtccttat
gaaaaacacaaggagtatggtcttttggacagatgctacaaaattccatctcggcatgca
actgaggaagacctcctgtgtttacacagcaaagagcatattgacaaaatgaaaagcact
caggacatgaagcctagagacctgtttaatcttggggaggagtatgattccatttatatg
agtaaggatgtttatgactgcgctctgttgtcatgtggctgcaccctagctgcagtggaa
catgtagccactaataagtcaagcaaacacagtattcacattaatcaactcttttttctc
agaccaccaggacaccatgctgatgctgactctgctatggggtattgttttttcaataac
gttgccattgctgcaaagcttgctcagcaaagatgggggatgcaaaggattttaattgtc
gactgggatatacatcacggcaatggaacgcaaaatctttttgagtctgatccaagtgtt
ctctacttttctcttcatcgttatgatcatgcaaacttctatccattctctgcacaagcc
aattacgatattgttggtaaagggcagggcaaaggatttaacgtcaatgtcccatggaac
aagagccatattggcgatgctgactacatagctgcttttcagcaaattttgcttcccatt
gcatatgagtttgatccggatattgtattggtctctgctggatttgactcagcaagaggg
gaccccaagggatactgcgacatcacccctgaaggttactgccatctgacgaacatgctg
atgagtttggctggtggcaaagtggtggtcattctggagggtggatataacattacatca
gttgctgagtccatgtgcagttgcacgtccaccttgcttggtgacccatgccctcgcctt
gatggcccaatggtgccatgtcagagtgtactgaagtctatatccaatgttgtgaatgtt
cacaagcagttctggaaaaatctcacg

DBGET integrated database retrieval system